Property Summary

NCBI Gene PubMed Count 14
PubMed Score 1.25
PubTator Score 2.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... -1.200 1.1e-02
osteosarcoma 1.217 1.8e-07
psoriasis -2.100 1.4e-05

Protein-protein Interaction (9)

Gene RIF (1)

AA Sequence

MALKRIQKELTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFT      1 - 70
TKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNRLARE     71 - 140
WTQKYAM                                                                   141 - 147
//

Text Mined References (14)

PMID Year Title