Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.45
PubTator Score 2.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis -2.100 1.4e-05
osteosarcoma 1.217 1.8e-07
intraductal papillary-mucinous neoplasm ... -1.200 1.1e-02

Synonym

Accession Q9Y2X8 A4D1V0
Symbols HBUCE1

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Xenopus OMA Inparanoid

AA Sequence

MALKRIQKELTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFT      1 - 70
TKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNRLARE     71 - 140
WTQKYAM                                                                   141 - 147
//

Text Mined References (13)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21685362 2011 The IDOL-UBE2D complex mediates sterol-dependent degradation of the LDL receptor.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20061386 2010 The E2 ubiquitin-conjugating enzymes direct polyubiquitination to preferred lysines.
19690564 2009 A comprehensive framework of E2-RING E3 interactions of the human ubiquitin-proteasome system.
19549727 2009 Analysis of the human E2 ubiquitin conjugating enzyme protein interaction network.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.