Property Summary

NCBI Gene PubMed Count 13
PubMed Score 150.35
PubTator Score 8.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Gene RIF (3)

PMID Text
23210642 These findings suggest that TXNDC9 gene may function in colorectalcancer development
22174782 PhLP3 is important for the maintenance of beta-tubulin levels in mammalian cells.
16415341 antagonistic actions of PhLP3 and prefoldin serve to modulate CCT activity and play a key role in establishing a functional cytoskeleton in vivo

AA Sequence

MEADASVDMFSKVLEHQLLQTTKLVEEHLDSEIQKLDQMDEDELERLKEKRLQALRKAQQQKQEWLSKGH      1 - 70
GEYREIPSERDFFQEVKESENVVCHFYRDSTFRCKILDRHLAILSKKHLETKFLKLNVEKAPFLCERLHI     71 - 140
KVIPTLALLKDGKTQDYVVGFTDLGNTDDFTTETLEWRLGSSDILNYSGNLMEPPFQNQKKFGTNFTKLE    141 - 210
KKTIRGKKYDSDSDDD                                                          211 - 226
//

Text Mined References (21)

PMID Year Title
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
23210642 2012 TXNDC9 expression in colorectal cancer cells and its influence on colorectal cancer prognosis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22174782 2011 Modulation of phosducin-like protein 3 (PhLP3) levels promotes cytoskeletal remodelling in a MAPK and RhoA-dependent manner.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19054851 2008 Human protein factory for converting the transcriptome into an in vitro-expressed proteome,.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16415341 2006 PhLP3 modulates CCT-mediated actin and tubulin folding via ternary complexes with substrates.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15009089 2004 An evolutionarily conserved gene required for proper microtubule architecture in Caenorhabditis elegans.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.