Property Summary

NCBI Gene PubMed Count 20
PubMed Score 32.38
PubTator Score 51.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
juvenile dermatomyositis 1.036 1.6e-11
ovarian cancer 1.800 1.3e-04

Gene RIF (5)

AA Sequence

METRPRLGATCLLGFSFLLLVISSDGHNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACK      1 - 70
ALKPKFAESTEISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSYKYF     71 - 140
YVSAEQVVQGMKEAQERLTGDAFRKKHLEDEL                                          141 - 172
//

Text Mined References (23)

PMID Year Title