Property Summary

NCBI Gene PubMed Count 19
PubMed Score 12.22
PubTator Score 7.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Lymphoma 57
Disease Target Count Z-score Confidence
Sleeping sickness 37 3.65 1.8

Expression

  Differential Expression (11)

Disease log2 FC p
Multiple myeloma 1.905 1.2e-03
astrocytic glioma 1.100 2.1e-02
ependymoma 1.100 1.9e-02
psoriasis 1.200 4.9e-04
osteosarcoma 1.031 2.2e-02
glioblastoma 1.100 2.3e-05
non-small cell lung cancer 1.090 3.3e-20
lung cancer 1.100 2.1e-02
pediatric high grade glioma 1.200 1.1e-04
ovarian cancer 1.400 3.4e-02
dermatomyositis 1.100 1.3e-02

Gene RIF (10)

PMID Text
23340433 An interleukin-6 family member, interleukin-11 is identified as a secondary target of twinfilin 1 in the microRNA-30c signalling pathway.
23224145 TWF1 and VIM are required for miR-30c to regulate breast cancer cell invasion.
20571053 protein overexpression promotes cardiomyocyte hypertrophy
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
19423540 Observational study of gene-disease association. (HuGE Navigator)
18976975 Knockdown of twinfilin, actin-binding protein, homolog 1 (TWF1) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
12807912 mammals have two twinfilin isoforms, which are differentially expressed and regulated through distinct cellular signaling pathways
12775419 Genes, including GABRP, ADF, HINT, PRSS2, SDCBP, PTK9, PPP2R5B, ITGA3, PRKCBP1, HMOX2, HAT1, PPP1cB, and ICAM-1, are upregulated after treatment of human astrocytes with HIV-1 gp120
12429826 These data suggest that the association with an actin monomer induces a first-order conformational change within the twinfilin molecule.

AA Sequence

MSHQTGIQASEDVKEIFARARNGKYRLLKISIENEQLVIGSYSQPSDSWDKDYDSFVLPLLEDKQPCYIL      1 - 70
FRLDSQNAQGYEWIFIAWSPDHSHVRQKMLYAATRATLKKEFGGGHIKDEVFGTVKEDVSLHGYKKYLLS     71 - 140
QSSPAPLTAAEEELRQIKINEVQTDVGVDTKHQTLQGVAFPISREAFQALEKLNNRQLNYVQLEIDIKNE    141 - 210
IIILANTTNTELKDLPKRIPKDSARYHFFLYKHSHEGDYLESIVFIYSMPGYTCSIRERMLYSSCKSRLL    211 - 280
EIVERQLQMDVIRKIEIDNGDELTADFLYEEVHPKQHAHKQSFAKPKGPAGKRGIRRLIRGPAETEATTD    281 - 350
//

Text Mined References (27)

PMID Year Title
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23340433 2013 MicroRNA-30c inhibits human breast tumour chemotherapy resistance by regulating TWF1 and IL-11.
23224145 2013 MicroRNA-30c targets cytoskeleton genes involved in breast cancer cell invasion.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21269460 2011 Initial characterization of the human central proteome.
20571053 2010 Attenuation of microRNA-1 derepresses the cytoskeleton regulatory protein twinfilin-1 to provoke cardiac hypertrophy.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
18837697 2009 Two biochemically distinct and tissue-specific twinfilin isoforms are generated from the mouse Twf2 gene by alternative promoter usage.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15188402 2004 Proteins associated with type II bone morphogenetic protein receptor (BMPR-II) and identified by two-dimensional gel electrophoresis and mass spectrometry.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12807912 2003 Mammals have two twinfilin isoforms whose subcellular localizations and tissue distributions are differentially regulated.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12429826 2002 The two ADF-H domains of twinfilin play functionally distinct roles in interactions with actin monomers.
12207032 2002 Structural conservation between the actin monomer-binding sites of twinfilin and actin-depolymerizing factor (ADF)/cofilin.
11870207 2002 Twinfilin, a molecular mailman for actin monomers.
10406962 1999 Cloning, expression and characterization of an A6-related protein.
7507208 1994 Prokaryotic expression cloning of a novel human tyrosine kinase.