Property Summary

NCBI Gene PubMed Count 20
PubMed Score 27.57
PubTator Score 8.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma 2.000 2.4e-07
oligodendroglioma 1.200 8.0e-03
psoriasis -1.100 2.4e-02
osteosarcoma -2.093 1.7e-05
group 4 medulloblastoma 1.500 1.2e-04
atypical teratoid / rhabdoid tumor 1.100 1.2e-03
medulloblastoma, large-cell 1.600 4.6e-05
Amyotrophic Lateral Sclerosis 1.129 2.5e-06
tuberculosis and treatment for 6 months 1.200 1.0e-03
aldosterone-producing adenoma -1.148 3.1e-02
ovarian cancer -2.000 2.4e-06

Gene RIF (5)

PMID Text
26079448 This study demonstrated that Overexpression and Nucleolar Localization gcp3 in glioblastoma.
23886939 Authors show genetically that GCP3/Spc98 function is fully conserved with Alp6 across species but that functional differences exist between GCP2/Spc97 and Alp4.
20858683 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19299467 Stability of the small gamma-tubulin complex (gamma tubulin/GCP2/GCP3) requires HCA66, a protein of the centrosome and the nucleolus.

AA Sequence

MATPDQKSPNVLLQNLCCRILGRSEADVAQQFQYAVRVIGSNFAPTVERDEFLVAEKIKKELIRQRREAD      1 - 70
AALFSELHRKLHSQGVLKNKWSILYLLLSLSEDPRRQPSKVSSYATLFAQALPRDAHSTPYYYARPQTLP     71 - 140
LSYQDRSAQSAQSSGSVGSSGISSIGLCALSGPAPAPQSLLPGQSNQAPGVGDCLRQQLGSRLAWTLTAN    141 - 210
QPSSQATTSKGVPSAVSRNMTRSRREGDTGGTMEITEAALVRDILYVFQGIDGKNIKMNNTENCYKVEGK    211 - 280
ANLSRSLRDTAVRLSELGWLHNKIRRYTDQRSLDRSFGLVGQSFCAALHQELREYYRLLSVLHSQLQLED    281 - 350
DQGVNLGLESSLTLRRLLVWTYDPKIRLKTLAALVDHCQGRKGGELASAVHAYTKTGDPYMRSLVQHILS    351 - 420
LVSHPVLSFLYRWIYDGELEDTYHEFFVASDPTVKTDRLWHDKYTLRKSMIPSFMTMDQSRKVLLIGKSI    421 - 490
NFLHQVCHDQTPTTKMIAVTKSAESPQDAADLFTDLENAFQGKIDAAYFETSKYLLDVLNKKYSLLDHMQ    491 - 560
AMRRYLLLGQGDFIRHLMDLLKPELVRPATTLYQHNLTGILETAVRATNAQFDSPEILRRLDVRLLEVSP    561 - 630
GDTGWDVFSLDYHVDGPIATVFTRECMSHYLRVFNFLWRAKRMEYILTDIRKGHMCNAKLLRNMPEFSGV    631 - 700
LHQCHILASEMVHFIHQMQYYITFEVLECSWDELWNKVQQAQDLDHIIAAHEVFLDTIISRCLLDSDSRA    701 - 770
LLNQLRAVFDQIIELQNAQDAIYRAALEELQRRLQFEEKKKQREIEGQWGVTAAEEEEENKRIGEFKESI    771 - 840
PKMCSQLRILTHFYQGIVQQFLVLLTTSSDESLRFLSFRLDFNEHYKAREPRLRVSLGTRGRRSSHT       841 - 907
//

Text Mined References (27)

PMID Year Title
26079448 2015 Overexpression and Nucleolar Localization of ?-Tubulin Small Complex Proteins GCP2 and GCP3 in Glioblastoma.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23886939 2013 Functional replacement of fission yeast ?-tubulin small complex proteins Alp4 and Alp6 by human GCP2 and GCP3.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21269460 2011 Initial characterization of the human central proteome.
20858683 2010 Common variants at 10 genomic loci influence hemoglobin A?(C) levels via glycemic and nonglycemic pathways.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19299467 2009 Stability of the small gamma-tubulin complex requires HCA66, a protein of the centrosome and the nucleolus.
17959831 2008 CDK5RAP2 is a pericentriolar protein that functions in centrosomal attachment of the gamma-tubulin ring complex.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12221128 2002 Centrosomal proteins CG-NAP and kendrin provide microtubule nucleation sites by anchoring gamma-tubulin ring complex.
11956313 2002 Direct binding of NuMA to tubulin is mediated by a novel sequence motif in the tail domain that bundles and stabilizes microtubules.
11694571 2001 GCP5 and GCP6: two new members of the human gamma-tubulin complex.
9566969 1998 Characterization of the human homologue of the yeast spc98p and its association with gamma-tubulin.
9566967 1998 The mammalian gamma-tubulin complex contains homologues of the yeast spindle pole body components spc97p and spc98p.
9138452 1997 The implications of a paternally derived centrosome during human fertilization: consequences for reproduction and the treatment of male factor infertility.
8838651 1996 Dynamic changes of NuMA during the cell cycle and possible appearance of a truncated form of NuMA during apoptosis.
7876350 1994 Recruitment of antigenic gamma-tubulin during mitosis in animal cells: presence of gamma-tubulin in the mitotic spindle.