Property Summary

NCBI Gene PubMed Count 25
PubMed Score 14.12
PubTator Score 15.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count P-value
lung carcinoma 2844 5.5e-26
breast carcinoma 1614 1.3e-24
Breast cancer 3098 5.9e-16
malignant mesothelioma 3163 3.9e-10
lung cancer 4473 2.7e-07
cystic fibrosis 1670 3.5e-06
lung adenocarcinoma 2714 2.6e-03
colon cancer 1475 2.3e-02

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma 5.500 3.9e-10
cystic fibrosis -2.537 3.5e-06
non-small cell lung cancer 1.017 1.7e-04
colon cancer -1.900 2.3e-02
lung cancer 4.900 2.7e-07
lung adenocarcinoma 1.400 2.6e-03
Breast cancer -3.500 5.9e-16
lung carcinoma 1.700 5.5e-26
breast carcinoma -1.700 1.3e-24

Gene RIF (17)

PMID Text
26331477 off-target, non-immune mediated effects of the mTOR-inhibitor everolimus on the podocyte cytoskeleton might involve regulation of microtubules, revealing a potential novel role of TUBB2B and DCDC2 in glomerular podocyte development
24392928 The present study confirms that mutations in tubulin genes are responsible for complex brain malformation.
23826228 HIV-1 Tat (specifically, amino acids 38-72), enhances tubulin polymerization and triggers the mitochondrial pathway to induce T cell apoptosis as shown in vitro by the release of cytochrome c from isolated mitochondria
23495813 The association of polymicrogyria with thin or absent corpus callosum, dysmorphic basal ganglia, brainstem and vermis hypoplasia is highly likely to result from mutations in TUBB2B.
23361065 The TUBB2B and TUBA1 coding regions have been sequenced in patients with cortical malformations associated with these genes.
23001566 Congenital fibrosis of the extraocular muscles and intellectual disability segregate with a heterozygous mutation in TUBB2B.
22591407 Brain malformations are associated with mutations in the beta-tubulin gene TUBB2B, supporting its critical role in migration/organization and axon guidance processes.
22333901 Three new TUBB2B mutations have been identified in three unrelated patients with a diffuse and rather symmetrical cortical abnormality.
22174317 HIV-1 Tat (specifically, amino acids 38-72), enhances tubulin polymerization and triggers the mitochondrial pathway to induce T cell apoptosis as shown in vitro by the release of cytochrome c from isolated mitochondria
19996274 Studies show that BFBTS bound and modified beta-tubulin at residue Cys12, forming beta-tubulin-SS-fluorobenzyl.
19465910 TUBB2B is required for neuronal migration two disease-associated mutations lead to impaired formation of tubulin heterodimers.
19165527 Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
18613117 The data suggest that the ratio of beta-tubulin classes II and V mRNA could be useful as a biomarker for NSCLC tumor differentiation and/or NSCLC aggressiveness.
16526095 HIV-1 Tat (specifically, amino acids 38-72), enhances tubulin polymerization and triggers the mitochondrial pathway to induce T cell apoptosis as shown in vitro by the release of cytochrome c from isolated mitochondria
15698476 HIV-1 Tat (specifically, amino acids 38-72), enhances tubulin polymerization and triggers the mitochondrial pathway to induce T cell apoptosis as shown in vitro by the release of cytochrome c from isolated mitochondria
15691386 HIV-1 Tat (specifically, amino acids 38-72), enhances tubulin polymerization and triggers the mitochondrial pathway to induce T cell apoptosis as shown in vitro by the release of cytochrome c from isolated mitochondria
12533264 The class II beta-tubulin isotype seems to be a promising predictive marker of docetaxel activity in the treatment of breast neoplasms.

AA Sequence

MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEP      1 - 70
GTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLG     71 - 140
GGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDI    141 - 210
CFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ    211 - 280
YRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVK    281 - 350
TAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS    351 - 420
EYQQYQDATADEQGEFEEEEGEDEA                                                 421 - 445
//

Text Mined References (29)

PMID Year Title
26875866 2016 Graded Control of Microtubule Severing by Tubulin Glutamylation.
26331477 2015 Everolimus Stabilizes Podocyte Microtubules via Enhancing TUBB2B and DCDC2 Expression.
24392928 2014 Brain malformations and mutations in ?- and ?-tubulin genes: a review of the literature and description of two new cases.
23495813 2014 Polymicrogyria with dysmorphic basal ganglia? Think tubulin!
23361065 2013 Overlapping cortical malformations and mutations in TUBB2B and TUBA1A.
23001566 2012 An inherited TUBB2B mutation alters a kinesin-binding site and causes polymicrogyria, CFEOM and axon dysinnervation.
22591407 2012 A novel mutation in the ?-tubulin gene TUBB2B associated with complex malformation of cortical development and deficits in axonal guidance.
22333901 2012 Symmetric polymicrogyria and pachygyria associated with TUBB2B gene mutations.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21525035 2011 PEX14 is required for microtubule-based peroxisome motility in human cells.
21269460 2011 Initial characterization of the human central proteome.
21078624 2011 Comparison of an expanded ataxia interactome with patient medical records reveals a relationship between macular degeneration and ataxia.
20191564 2010 Tumoral and tissue-specific expression of the major human beta-tubulin isotypes.
19996274 2009 Natural product derivative Bis(4-fluorobenzyl)trisulfide inhibits tumor growth by modification of beta-tubulin at Cys 12 and suppression of microtubule dynamics.
19524510 2009 Evolutionary divergence of enzymatic mechanisms for posttranslational polyglycylation.
19465910 2009 Mutations in the beta-tubulin gene TUBB2B result in asymmetrical polymicrogyria.
19165527 2009 Prefrontal cortex shotgun proteome analysis reveals altered calcium homeostasis and immune system imbalance in schizophrenia.
18613117 2008 Beta-tubulin isotype classes II and V expression patterns in nonsmall cell lung carcinomas.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16371510 2006 Microtubule regulation in mitosis: tubulin phosphorylation by the cyclin-dependent kinase Cdk1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12533264 2002 Microtubule-associated parameters as predictive markers of docetaxel activity in advanced breast cancer patients: results of a pilot study.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
6688039 1983 Evolutionary history of a multigene family: an expressed human beta-tubulin gene and three processed pseudogenes.