Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.40
PubTator Score 2.53

Knowledge Summary

Patent (738)

TINX Plot

  Disease (1)

Disease Target Count P-value
Breast cancer 3098 9.4e-06
glioblastoma 5572 3.3e-04
atypical teratoid / rhabdoid tumor 4369 1.2e-03
osteosarcoma 7933 3.1e-03

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma 1.278 3.1e-03
atypical teratoid / rhabdoid tumor 1.200 1.2e-03
glioblastoma 1.400 3.3e-04
Breast cancer 1.700 9.4e-06

 GWAS Trait (1)

Gene RIF (1)

PMID Text
18577513 Nedd4-2 differentially interacts with and regulates TTYH1-3

AA Sequence

MAGVSYAAPWWVSLLHRLPHFDLSWEATSSQFRPEDTDYQQALLLLGAAALACLALDLLFLLFYSFWLCC      1 - 70
RRRKSEEHLDADCCCTAWCVIIATLVCSAGIAVGFYGNGETSDGIHRATYSLRHANRTVAGVQDRVWDTA     71 - 140
VGLNHTAEPSLQTLERQLAGRPEPLRAVQRLQGLLETLLGYTAAIPFWRNTAVSLEVLAEQVDLYDWYRW    141 - 210
LGYLGLLLLDVIICLLVLVGLIRSSKGILVGVCLLGVLALVISWGALGLELAVSVGSSDFCVDPDAYVTK    211 - 280
MVEEYSVLSGDILQYYLACSPRAANPFQQKLSGSHKALVEMQDVVAELLRTVPWEQPATKDPLLRVQEVL    281 - 350
NGTEVNLQHLTALVDCRSLHLDYVQALTGFCYDGVEGLIYLALFSFVTALMFSSIVCSVPHTWQQKRGPD    351 - 420
EDGEEEAAPGPRQAHDSLYRVHMPSLYSCGSSYGSETSIPAAAHTVSNAPVTEYMSQNANFQNPRCENTP    421 - 490
LIGRESPPPSYTSSMRAKYLATSQPRPDSSGSH                                         491 - 523
//

Text Mined References (18)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18577513 2008 The ubiquitin-protein ligase Nedd4-2 differentially interacts with and regulates members of the Tweety family of chloride ion channels.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16219661 2006 The Drosophila tweety family: molecular candidates for large-conductance Ca2+-activated Cl- channels.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15010458 2004 A novel human Cl(-) channel family related to Drosophila flightless locus.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12693554 2003 Characterization of long cDNA clones from human adult spleen. II. The complete sequences of 81 cDNA clones.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
11214970 2000 Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.