Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.00
PubTator Score 9.18

Knowledge Summary

Patent (285)


  Differential Expression (7)

Gene RIF (3)

25182704 TTYH1 was not expressed in either the malignant or the control samples
24316981 Fusion of TTYH1 with the C19MC microRNA cluster drives expression of a brain-specific DNMT3B isoform in the embryonal brain tumor.
18577513 Nedd4-2 differentially interacts with and regulates TTYH1-3

AA Sequence

PPSDDYDDTDDDDPFNPQESKRFVQWQSSI                                            421 - 450

Text Mined References (13)

PMID Year Title
25182704 2014 Validation of analytical breast cancer microarray analysis in medical laboratory.
24316981 2014 Fusion of TTYH1 with the C19MC microRNA cluster drives expression of a brain-specific DNMT3B isoform in the embryonal brain tumor ETMR.
23720494 2013 Genome-wide association study identifies loci affecting blood copper, selenium and zinc.
18577513 2008 The ubiquitin-protein ligase Nedd4-2 differentially interacts with and regulates members of the Tweety family of chloride ion channels.
17116230 2007 Expression and evolution of the mammalian brain gene Ttyh1.
16219661 2006 The Drosophila tweety family: molecular candidates for large-conductance Ca2+-activated Cl- channels.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
15010458 2004 A novel human Cl(-) channel family related to Drosophila flightless locus.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10950931 2000 Human and mouse homologues of the Drosophila melanogaster tweety (tty) gene: a novel gene family encoding predicted transmembrane proteins.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.