Property Summary

NCBI Gene PubMed Count 14
PubMed Score 5.84
PubTator Score 5.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 9.1e-09
tuberculosis 1563 6.6e-05
psoriasis 6685 4.9e-03
Disease Target Count Z-score Confidence
Primary ciliary dyskinesia 75 3.504 1.8

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis 1.100 4.9e-03
tuberculosis 1.100 6.6e-05
posterior fossa group B ependymoma 1.200 9.1e-09

 IMPC Phenotype (1)

 GWAS Trait (1)

Pathway (1)

Gene RIF (3)

PMID Text
20564319 Meta-analysis of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19767753 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)

AA Sequence

MAGKVKWVTDIEKSVLINNFEKRGWVQVTENEDWNFYWMSVQTIRNVFSVEAGYRLSDDQIVNHFPNHYE      1 - 70
LTRKDLMVKNIKRYRKELEKEGSPLAEKDENGKYLYLDFVPVTYMLPADYNLFVEEFRKSPSSTWIMKPC     71 - 140
GKAQGKGIFLINKLSQIKKWSRDSKTSSFVSQSNKEAYVISLYINNPLLIGGRKFDLRLYVLVSTYRPLR    141 - 210
CYMYKLGFCRFCTVKYTPSTSELDNMFVHLTNVAIQKHGEDYNHIHGGKWTVSNLRLYLESTRGKEVTSK    211 - 280
LFDEIHWIIVQSLKAVAPVMNNDKHCFECYGYDIIIDDKLKPWLIEVNASPSLTSSTANDRILKYNLIND    281 - 350
TLNIAVPNGEIPDCKWNKSPPKEVLGNYEILYDEELAQGDGADRELRSRQGQSLGPRAGRSRDSGRAVLT    351 - 420
TWK                                                                       421 - 423
//

Text Mined References (14)

PMID Year Title
20564319 2010 Prostate cancer risk-associated variants reported from genome-wide association studies: meta-analysis and their contribution to genetic Variation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19767753 2009 Identification of seven new prostate cancer susceptibility loci through a genome-wide association study.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15890843 2005 Tubulin polyglutamylase enzymes are members of the TTL domain protein family.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12529303 2003 Reevaluating human gene annotation: a second-generation analysis of chromosome 22.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11054573 2000 Characterization of the human tubulin tyrosine ligase-like 1 gene (TTLL1) mapping to 22q13.1.
10591208 1999 The DNA sequence of human chromosome 22.
8724849 1996 Prediction of the coding sequences of unidentified human genes. V. The coding sequences of 40 new genes (KIAA0161-KIAA0200) deduced by analysis of cDNA clones from human cell line KG-1.