Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.70
PubTator Score 1.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
ovarian cancer 8520 2.7e-06
osteosarcoma 7950 3.1e-06
group 3 medulloblastoma 4104 2.9e-05
Waldenstrons macroglobulinemia 765 8.8e-04
lung cancer 4740 1.9e-02
acute myeloid leukemia 783 4.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Orofacial cleft 54 0.0 1.4
Disease Target Count Z-score Confidence
Sleep apnea 7 3.274 1.6

Expression

  Differential Expression (6)

Disease log2 FC p
acute myeloid leukemia -1.700 4.5e-02
group 3 medulloblastoma 1.600 2.9e-05
lung cancer 1.300 1.9e-02
osteosarcoma -1.501 3.1e-06
ovarian cancer -1.400 2.7e-06
Waldenstrons macroglobulinemia 1.476 8.8e-04

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (2)

Gene RIF (1)

AA Sequence

MWTPELAILRGFPTEAERQQWKQEGVVGSESGSFLQLLLEGNYEAIFLNSMTQNIFNSTTTAEEKIDSYL      1 - 70
EKQVVTFLDYSTDLDTTERQQLIFLLGVSSLQLFVQSNWTGPPVDLHPQDFLSSVLFQQFSEVKGLDAFV     71 - 140
LSLLTLDGESIYSLTSKPILLLLARIILVNVRHKLTAIQSLPWWTLRCVNIHQHLLEERSPLLFTLAENC    141 - 210
IDQVMKLQNLFVDDSGRYLAIQFHLECAYVFLYYYEYRKAKDQLDIAKDISQLQIDLTGALGKRTRFQEN    211 - 280
YVAQLILDVRREGDVLSNCEFTPAPTPQEHLTKNLELNDDTILNDIKLADCEQFQMPDLCAEEIAIILGI    281 - 350
CTNFQKNNPVHTLTEVELLAFTSCLLSQPKFWAIQTSALILRTKLEKGSTRRVERAMRQTQALADQFEDK    351 - 420
TTSVLERLKIFYCCQVPPHWAIQRQLASLLFELGCTSSALQIFEKLEMWEDVVICYERAGQHGKAEEILR    421 - 490
QELEKKETPSLYCLLGDVLGDHSCYDKAWELSRYRSARAQRSKALLHLRNKEFQECVECFERSVKINPMQ    491 - 560
LGVWFSLGCAYLALEDYQGSAKAFQRCVTLEPDNAEAWNNLSTSYIRLKQKVKAFRTLQEALKCNYEHWQ    561 - 630
IWENYILTSTDVGEFSEAIKAYHRLLDLRDKYKDVQVLKILVRAVIDGMTDRSGDVATGLKGKLQELFGR    631 - 700
VTSRVTNDGEIWRLYAHVYGNGQSEKPDENEKAFQCLSKAYKCDTQSNCWEKDITSFKEVVQRALGLAHV    701 - 770
AIKCSKNKSSSQEAVQMLSSVRLNLRGLLSKAKQLFTDVATGEMSRELADDITAMDTLVTELQDLSNQFR    771 - 840
NQY                                                                       841 - 843
//

Text Mined References (10)

PMID Year Title