Property Summary

NCBI Gene PubMed Count 7
PubMed Score 4.11
PubTator Score 1.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
posterior fossa group B ependymoma 3.200 2.4e-15
osteosarcoma 1.885 1.3e-03
glioblastoma 1.400 2.3e-05
group 3 medulloblastoma 1.600 1.7e-04
atypical teratoid / rhabdoid tumor 1.700 6.3e-08
medulloblastoma, large-cell 1.400 4.7e-05
primitive neuroectodermal tumor 1.500 2.7e-03
lung cancer 1.800 3.2e-03
pediatric high grade glioma 1.200 1.3e-05
chronic rhinosinusitis -1.868 2.7e-02

 GWAS Trait (1)

Protein-protein Interaction (6)

Gene RIF (3)

PMID Text
24596149 TTC26 is an intraflagellar transport protein required for transport of motility-related proteins into flagella.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MMLSRAKPAVGRGVQHTDKRKKKGRKIPKLEELLSKRDFTGAITLLEFKRHVGEEEEDTNLWIGYCAFHL      1 - 70
GDYKRALEEYENATKEENCNSEVWVNLACTYFFLGMYKQAEAAGFKASKSRLQNRLLFHLAHKFNDEKKL     71 - 140
MSFHQNLQDVTEDQLSLASIHYMRSHYQEAIDIYKRILLDNREYLALNVYVALCYYKLDYYDVSQEVLAV    141 - 210
YLQQIPDSTIALNLKACNHFRLYNGRAAEAELKSLMDNASSSFEFAKELIRHNLVVFRGGEGALQVLPPL    211 - 280
VDVIPEARLNLVIYYLRQDDVQEAYNLIKDLEPTTPQEYILKGVVNAALGQEMGSRDHMKIAQQFFQLVG    281 - 350
GSASECDTIPGRQCMASCFFLLKQFDDVLIYLNSFKSYFYNDDIFNFNYAQAKAATGNTSEGEEAFLLIQ    351 - 420
SEKMKNDYIYLSWLARCYIMNKKPRLAWELYLKMETSGESFSLLQLIANDCYKMGQFYYSAKAFDVLERL    421 - 490
DPNPEYWEGKRGACVGIFQMIIAGREPKETLREVLHLLRSTGNTQVEYMIRIMKKWAKENRVSI          491 - 554
//

Text Mined References (11)

PMID Year Title
24596149 2014 TTC26/DYF13 is an intraflagellar transport protein required for transport of motility-related proteins into flagella.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.