Property Summary

NCBI Gene PubMed Count 43
PubMed Score 231.75
PubTator Score 223.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
malignant mesothelioma -1.200 3.8e-06
psoriasis 2.300 8.3e-05
osteosarcoma -1.883 2.5e-05
medulloblastoma, large-cell -1.100 1.3e-02
tuberculosis 1.700 6.9e-10
pancreatic ductal adenocarcinoma liver m... -1.468 4.9e-03
intraductal papillary-mucinous adenoma (... 1.100 6.0e-04
intraductal papillary-mucinous neoplasm ... 1.200 3.8e-03
colon cancer -1.300 3.0e-03
interstitial cystitis -1.200 7.1e-05
atypical teratoid/rhabdoid tumor -1.100 1.3e-04
group 4 medulloblastoma -1.800 3.1e-05
lung carcinoma -1.300 5.4e-20
ulcerative colitis -1.500 2.5e-06
ovarian cancer -2.100 3.0e-07
pituitary cancer -1.500 2.5e-06

Protein-protein Interaction (1)

Gene RIF (7)

PMID Text
26269602 show that polymorphic variations that are distant from the active site differentially modulate the sulfurtransferase activity of human rhodanese to cyanide versus sulfite
23399736 Loss of Thiosulfate Sulfurtransferase is associated with decreased mucosal sulfide detoxification capacity in patients with Crohn's disease
20877624 Observational study of gene-disease association. (HuGE Navigator)
20663881 silencing of the rhodanese gene caused not only a proportional decrease of 5 S rRNA import but also a general inhibition of mitochondrial translation, indicating the functional importance of the imported 5 S rRNA inside the organelle.
20099848 Proteomics was used to study colonic epithelial aging, for differential proteins in the human normal colonic epithelial tissues from young and old people. Rack1, EF-Tu and Rhodanese, three validated differential proteins, were further investigated.
17035239 The USP8 recognition domain of NRDP1 has a novel protein fold that interacts with a conserved peptide loop of the rhodanese domain.
15910006 A partially gluconoylated N-terminus of the His6-tagged molybdenum cofactor synthesis 3 (MOCS3)-rhodanese-like domain is identified which results in a heterogeneity of the protein but does not influence sulfurtransferase activity.

AA Sequence

MVHQVLYRALVSTKWLAESIRTGKLGPGLRVLDASWYSPGTREARKEYLERHVPGASFFDIEECRDTASP      1 - 70
YEMMLPSEAGFAEYVGRLGISNHTHVVVYDGEHLGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHP     71 - 140
VTSEPSRPEPAVFKATLDRSLLKTYEQVLENLESKRFQLVDSRSQGRFLGTEPEPDAVGLDSGHIRGAVN    141 - 210
MPFMDFLTEDGFEKGPEELRALFQTKKVDLSQPLIATCRKGVTACHVALAAYLCGKPDVAVYDGSWSEWF    211 - 280
RRAPPESRVSQGKSEKA                                                         281 - 297
//

Text Mined References (47)

PMID Year Title
26269602 2015 Polymorphic Variants of Human Rhodanese Exhibit Differences in Thermal Stability and Sulfur Transfer Kinetics.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
23399736 2013 Decreased mucosal sulfide detoxification capacity in patients with Crohn's disease.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21922874 Assessment of cassava toxicity in patients with tropical chronic pancreatitis.
21685364 2011 Biological significance of 5S rRNA import into human mitochondria: role of ribosomal protein MRP-L18.
21492153 2011 Analysis of proteomic changes induced upon cellular differentiation of the human intestinal cell line Caco-2.
21269460 2011 Initial characterization of the human central proteome.
21175961 2010 Thiol levels, protein carbonylation and anaerobic sulfur metabolism in erythrocytes of peritoneal dialysis and predialysis patients.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20663881 2010 Mitochondrial enzyme rhodanese is essential for 5 S ribosomal RNA import into human mitochondria.
20099848 2010 Identification of Rack1, EF-Tu and Rhodanese as aging-related proteins in human colonic epithelium by proteomic analysis.
19695240 2010 Low expression of thiosulfate sulfurtransferase (rhodanese) predicts mortality in hemodialysis patients.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16790311 2006 Evidence for a functional genetic polymorphism of the human thiosulfate sulfurtransferase (Rhodanese), a cyanide and H2S detoxification enzyme.
16500920 2006 Sulfide-detoxifying enzymes in the human colon are decreased in cancer and upregulated in differentiation.
16343079 2005 Altered protein expression and protein nitration pattern during d-galactosamine-induced cell death in human hepatocytes: a proteomic analysis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15153070 2004 A co-translational model to explain the in vivo import of proteins into HeLa cell mitochondria.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12962704 2003 Inhibition of the catalytic activity of rhodanese by S-nitrosylation using nitric oxide donors.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11788560 2002 Mucosal protection against sulphide: importance of the enzyme rhodanese.
11112515 2000 Interaction of a mitochondrial presequence with lipid membranes: role of helix formation for membrane binding and perturbation.
10591208 1999 The DNA sequence of human chromosome 22.
9070219 1997 Cloning and expression of human liver rhodanese cDNA.
8404072 1994 Chromosome assignment of human brain expressed sequence tags (ESTs) by analyzing fluorescently labeled PCR products from hybrid cell panels.
8340386 1993 Limited tryptic digestion near the amino terminus of bovine liver rhodanese produces active electrophoretic variants with altered refolding.
8254022 1993 Mitochondrial myopathy with succinate dehydrogenase and aconitase deficiency. Abnormalities of several iron-sulfur proteins.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
6928732 1980 Genetic polymorphism of rhodanese from human erythrocytes.
6588145 1984 Regional and subcellular distribution of cyanide metabolizing enzymes in the central nervous system.
6573305 1983 Histochemical detection of thiosulphate sulphurtransferase (rhodanese) activity.
6402020 1983 Interaction of rhodanese with mitochondrial NADH dehydrogenase.
3479705 1987 Normal rhodanese activity in leukocytes from Leber patients: enzyme characterization and activity levels.
3471602 1987 Red blood cell rhodanese: its possible role in modulating delta-aminolaevulinate synthetase activity in mammals.
3178139 1988 Rhodanese isozymes in human tissues.
2817794 Inactivation of rhodanese from human gastric mucosa and stomach adenocarcinoma by 2,4, 6-trinitrobenzenesulphonate and by 4,4'-diisothiocyanatostilbene-2,2'-disulphonate.
2006499 1991 The cyanide-metabolizing enzyme rhodanese in human nasal respiratory mucosa.
1691817 1990 Synthesis of rhodanese in Hep 3B cells.
1451437 1992 Heme biosynthesis pathway regulation in a model of hepatocarcinogenesis pre-initiation.
986188 1976 Reaction of rhodanese with dithiothreitol.