Property Summary

NCBI Gene PubMed Count 12
PubMed Score 6.55
PubTator Score 45.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
adrenocortical carcinoma 1.091 1.1e-02
adult high grade glioma -1.500 7.6e-04
Astrocytoma, Pilocytic -1.900 3.9e-05
atypical teratoid / rhabdoid tumor -2.500 4.0e-05
Breast cancer -1.200 6.3e-03
cystic fibrosis 1.044 5.2e-05
ductal carcinoma in situ 1.400 1.2e-02
ependymoma -1.400 5.3e-07
glioblastoma -1.400 7.8e-05
intraductal papillary-mucinous adenoma (... 2.000 4.8e-05
intraductal papillary-mucinous carcinoma... 1.300 1.1e-02
intraductal papillary-mucinous neoplasm ... 1.500 1.9e-03
lung cancer 2.100 3.3e-04
malignant mesothelioma -2.300 1.7e-07
medulloblastoma -1.300 1.4e-03
medulloblastoma, large-cell -2.000 9.3e-03
non-small cell lung cancer 1.329 9.0e-13
osteosarcoma -2.130 1.2e-02
ovarian cancer -3.100 1.0e-19
pancreatic cancer 1.100 2.1e-04
primitive neuroectodermal tumor -1.200 3.5e-02
psoriasis 1.100 2.6e-04
subependymal giant cell astrocytoma -2.372 3.4e-02
tuberculosis and treatment for 6 months -1.200 1.9e-02
ulcerative colitis 1.200 1.3e-05
urothelial carcinoma -1.300 2.5e-02

 GWAS Trait (1)

Gene RIF (5)

AA Sequence

MSGKHYKGPEVSCCIKYFIFGFNVIFWFLGITFLGIGLWAWNEKGVLSNISSITDLGGFDPVWLFLVVGG      1 - 70
VMFILGFAGCIGALRENTFLLKFFSVFLGIIFFLELTAGVLAFVFKDWIKDQLYFFINNNIRAYRDDIDL     71 - 140
QNLIDFTQEYWQCCGAFGADDWNLNIYFNCTDSNASRERCGVPFSCCTKDPAEDVINTQCGYDARQKPEV    141 - 210
DQQIVIYTKGCVPQFEKWLQDNLTIVAGIFIGIALLQIFGICLAQNLVSDIEAVRASW                211 - 268
//

Text Mined References (13)

PMID Year Title