Property Summary

NCBI Gene PubMed Count 9
PubMed Score 6.26
PubTator Score 45.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
urothelial carcinoma -1.800 3.0e-02
malignant mesothelioma -2.300 1.7e-07
psoriasis 1.100 2.6e-04
osteosarcoma -3.192 4.2e-04
ependymoma -1.400 5.3e-07
glioblastoma -1.500 6.5e-04
cystic fibrosis 1.600 1.9e-04
atypical teratoid / rhabdoid tumor -2.500 4.0e-05
medulloblastoma -1.300 1.4e-03
medulloblastoma, large-cell -2.100 1.3e-02
primitive neuroectodermal tumor -1.300 2.9e-02
adrenocortical carcinoma 1.414 1.0e-02
tuberculosis and treatment for 6 months -1.200 1.9e-02
non-small cell lung cancer 1.359 2.8e-14
intraductal papillary-mucinous adenoma (... 2.000 4.8e-05
intraductal papillary-mucinous carcinoma... 1.300 1.1e-02
intraductal papillary-mucinous neoplasm ... 1.500 1.9e-03
lung cancer 3.100 1.1e-06
pancreatic cancer 1.100 2.1e-04
adult high grade glioma -1.500 7.6e-04
pilocytic astrocytoma -1.900 3.4e-05
subependymal giant cell astrocytoma -2.803 3.0e-03
Breast cancer -1.200 6.3e-03
ductal carcinoma in situ 1.400 1.2e-02
ulcerative colitis 1.200 1.3e-05
ovarian cancer -3.100 1.0e-19

Pathway (1)

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19460752 Knockdown of tetraspanin 5 (TSPAN5) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells

AA Sequence

MSGKHYKGPEVSCCIKYFIFGFNVIFWFLGITFLGIGLWAWNEKGVLSNISSITDLGGFDPVWLFLVVGG      1 - 70
VMFILGFAGCIGALRENTFLLKFFSVFLGIIFFLELTAGVLAFVFKDWIKDQLYFFINNNIRAYRDDIDL     71 - 140
QNLIDFTQEYWQCCGAFGADDWNLNIYFNCTDSNASRERCGVPFSCCTKDPAEDVINTQCGYDARQKPEV    141 - 210
DQQIVIYTKGCVPQFEKWLQDNLTIVAGIFIGIALLQIFGICLAQNLVSDIEAVRASW                211 - 268
//

Text Mined References (10)

PMID Year Title
26686862 2016 TspanC8 tetraspanins differentially regulate the cleavage of ADAM10 substrates, Notch activation and ADAM10 membrane compartmentalization.
23091066 2012 TspanC8 tetraspanins regulate ADAM10/Kuzbanian trafficking and promote Notch activation in flies and mammals.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11739647 2001 Complexes of tetraspanins with integrins: more than meets the eye.
10719184 2000 Sequence and expression of seven new tetraspans.
9714763 1998 Sequences and expression of six new members of the tetraspanin/TM4SF family.