Property Summary

NCBI Gene PubMed Count 13
PubMed Score 5.29
PubTator Score 2.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Multiple myeloma 1.841 9.7e-04
oligodendroglioma 1.500 4.7e-02
Barrett's esophagus 1.400 4.0e-02
esophageal adenocarcinoma 1.500 1.8e-02
osteosarcoma -1.498 3.0e-04
posterior fossa group B ependymoma 1.300 1.7e-08
intraductal papillary-mucinous carcinoma... 1.100 2.4e-02
intraductal papillary-mucinous neoplasm ... 1.600 5.0e-03
lung cancer -1.200 3.1e-04
non primary Sjogren syndrome sicca 1.200 2.4e-02
lung adenocarcinoma 1.245 8.4e-05
ductal carcinoma in situ -1.500 3.2e-03
invasive ductal carcinoma -1.300 3.6e-02
ovarian cancer -2.200 4.8e-06
pancreatic cancer 1.300 2.0e-02

Gene RIF (2)

PMID Text
26930362 Studies indicate that tetraspanin 3 has a critical role in acute myeloid leukemia.
26212080 Tspan3 is an important regulator of aggressive leukemias.

AA Sequence

MGQCGITSSKTVLVFLNLIFWGAAGILCYVGAYVFITYDDYDHFFEDVYTLIPAVVIIAVGALLFIIGLI      1 - 70
GCCATIRESRCGLATFVIILLLVFVTEVVVVVLGYVYRAKVENEVDRSIQKVYKTYNGTNPDAASRAIDY     71 - 140
VQRQLHCCGIHNYSDWENTDWFKETKNQSVPLSCCRETASNCNGSLAHPSDLYAEGCEALVVKKLQEIMM    141 - 210
HVIWAALAFAAIQLLGMLCACIVLCRRSRDPAYELLITGGTYA                               211 - 253
//

Text Mined References (14)

PMID Year Title
26930362 2016 Tetraspanins: Spanning from solid tumors to hematologic malignancies.
26212080 2015 Tetraspanin 3 Is Required for the Development and Propagation of Acute Myelogenous Leukemia.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11739647 2001 Complexes of tetraspanins with integrins: more than meets the eye.
9714763 1998 Sequences and expression of six new members of the tetraspanin/TM4SF family.
1840594 1991 Activation of globin gene expression by cDNAs from induced K562 cells. Evidence for involvement of ferritin in globin gene expression.