Property Summary

NCBI Gene PubMed Count 32
PubMed Score 21.47
PubTator Score 74.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma 2.100 1.4e-04
astrocytic glioma 2.500 4.1e-03
Astrocytoma, Pilocytic 1.700 2.7e-06
Breast cancer -2.000 1.6e-04
colon cancer 1.700 2.2e-02
glioblastoma 1.700 8.1e-06
interstitial cystitis -1.900 2.0e-03
interstitial lung disease -1.700 5.2e-03
lung adenocarcinoma -1.400 6.8e-11
lung carcinoma -1.400 1.6e-05
malignant mesothelioma -1.600 7.6e-07
medulloblastoma, large-cell -1.100 1.2e-02
non-small cell lung cancer -2.372 8.9e-20
oligodendroglioma 1.600 3.6e-02
ovarian cancer 1.600 2.7e-02
pituitary cancer -2.800 2.5e-06
sonic hedgehog group medulloblastoma 1.100 3.9e-02

Gene RIF (23)

AA Sequence

MAREDSVKCLRCLLYALNLLFWLMSISVLAVSAWMRDYLNNVLTLTAETRVEEAVILTYFPVVHPVMIAV      1 - 70
CCFLIIVGMLGYCGTVKRNLLLLAWYFGSLLVIFCVELACGVWTYEQELMVPVQWSDMVTLKARMTNYGL     71 - 140
PRYRWLTHAWNFFQREFKCCGVVYFTDWLEMTEMDWPPDSCCVREFPGCSKQAHQEDLSDLYQEGCGKKM    141 - 210
YSFLRGTKQLQVLRFLGISIGVTQILAMILTITLLWALYYDRREPGTDQMMSLKNDNSQHLSCPSVELLK    211 - 280
PSLSRIFEHTSMANSFNTHFEMEEL                                                 281 - 305
//

Text Mined References (34)

PMID Year Title