Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.64
PubTator Score 0.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
Rheumatoid Arthritis 1.100 2.2e-02
hepatocellular carcinoma -1.100 9.9e-04
Multiple myeloma 1.264 3.5e-03
malignant mesothelioma 1.900 1.6e-06
psoriasis -1.500 9.7e-05
osteosarcoma 2.048 1.2e-06
glioblastoma -2.100 2.3e-05
atypical teratoid / rhabdoid tumor -2.100 6.5e-05
medulloblastoma -1.400 2.7e-05
medulloblastoma, large-cell -2.000 1.2e-03
autosomal dominant Emery-Dreifuss muscul... 1.160 3.0e-03
juvenile dermatomyositis 1.107 1.7e-08
Amyotrophic Lateral Sclerosis 1.130 6.3e-06
tuberculosis and treatment for 6 months 1.500 2.2e-03
intraductal papillary-mucinous neoplasm ... 1.200 2.1e-02
lung cancer -2.100 4.6e-04
colon cancer -1.800 8.3e-04
adult high grade glioma -2.000 5.5e-05
pilocytic astrocytoma -1.800 2.1e-06
spina bifida -2.546 2.7e-02
Pick disease -1.100 1.5e-02
ovarian cancer 1.800 4.2e-04

Synonym

Accession O75157 D3DNI5 Q6PI50 Q9H2Z6 Q9H2Z7 Q9H2Z8
Symbols TILZ4a
TILZ4b
TILZ4c

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Mouse OMA Inparanoid

Gene RIF (1)

PMID Text
20149264 Long form of TSC22DF is evolutionarily conserved and has growth-regulating potential.

AA Sequence

MSKMPAKKKSCFQITSVTTAQVATSITEDTESLDDPDESRTEDVSSEIFDVSRATDYGPEEVCERSSSEE      1 - 70
TLNNVGDAETPGTVSPNLLLDGQLAAAAAAPANGGGVVSARSVSGALASTLAAAATSAPAPGAPGGPQLA     71 - 140
GSSAGPVTAAPSQPPTTCSSRFRVIKLDHGSGEPYRRGRWTCMEYYERDSDSSVLTRSGDCIRHSSTFDQ    141 - 210
TAERDSGLGATGGSVVVVVASMQGAHGPESGTDSSLTAVSQLPPSEKMSQPTPAQPQSFSVGQPQPPPPP    211 - 280
VGGAVAQSSAPLPPFPGAATGPQPMMAAAQPSQPQGAGPGGQTLPPTNVTLAQPAMSLPPQPGPAVGAPA    281 - 350
AQQPQQFAYPQPQIPPGHLLPVQPSGQSEYLQQHVAGLQPPSPAQPSSTGAAASPATAATLPVGTGQNAS    351 - 420
SVGAQLMGASSQPSEAMAPRTGPAQGGQVAPCQPTGVPPATVGGVVQPCLGPAGAGQPQSVPPPQMGGSG    421 - 490
PLSAVPGGPHAVVPGVPNVPAAVPAPSVPSVSTTSVTMPNVPAPLAQSQQLSSHTPVSRSSSIIQHVGLP    491 - 560
LAPGTHSAPTSLPQSDLSQFQTQTQPLVGQVDDTRRKSEPLPQPPLSLIAENKPVVKPPVADSLANPLQL    561 - 630
TPMNSLATSVFSIAIPVDGDEDRNPSTAFYQAFHLNTLKESKSLWDSASGGGVVAIDNKIEQAMDLVKSH    631 - 700
LMYAVREEVEVLKEQIKELVERNSLLERENALLKSLSSNDQLSQLPTQQANPGSTSQQQAVIAQPPQPTQ    701 - 770
PPQQPNVSSA                                                                771 - 780
//

Text Mined References (11)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22479202 2012 Novel loci for adiponectin levels and their influence on type 2 diabetes and metabolic traits: a multi-ethnic meta-analysis of 45,891 individuals.
21269460 2011 Initial characterization of the human central proteome.
20149264 2010 Madm (Mlf1 adapter molecule) cooperates with Bunched A to promote growth in Drosophila.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9734811 1998 Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.