Property Summary

NCBI Gene PubMed Count 46
PubMed Score 31.20
PubTator Score 34.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
glioblastoma 1.900 3.3e-05
ependymoma 1.900 1.1e-08
astrocytoma 2.000 8.4e-03
atypical teratoid / rhabdoid tumor 1.800 1.5e-04
breast carcinoma 1.300 4.3e-02
pediatric high grade glioma 1.600 1.2e-05
group 4 medulloblastoma -1.600 2.2e-05
pilocytic astrocytoma 1.300 4.2e-06
subependymal giant cell astrocytoma 1.946 9.2e-03
ovarian cancer 2.600 1.9e-07
pituitary cancer -1.500 3.6e-06

Gene RIF (22)

PMID Text
25673849 the Trip6-GRIP1-myosin VI interaction and its regulation on F-actin network play a significant role in dendritic morphogenesis
24033704 TRIP6 acts, in contrast to Zyxin, as an oncogene that partially accounts for the autonomous migratory, invasive and proliferative properties of Ewing's sarcoma cells.
24033704 TRIP6 overexpression promotes migration, invasion, and clonogenicity of Ewing's sarcoma cells
23576104 TRIP6 is involved in the regulation of nasopharyngeal carcinoma cell motility, and phosphorylation of tyrosine 55 residue plays an important regulatory role for this event
23339869 TRIP6 also promotes serum-induced reduction of nuclear p27(KIP1) expression levels.
23313295 High TRIP6 expression is associated with malignant pleural mesothelioma.
22054418 TRIP6 is engaged in cell proliferation, differentiation, transcription regulation and contributes to genome stability. [Review]
22054418 TRIP6 is a nucleocytoplasmatic shuttle protein essential for the coordination of focal adhesion dynamics and transcriptional responses in lysophosphosphatidic (LPA) and NF-kappaB signaling.
21689746 TRIP6 is an adaptor protein that regulates cell motility, antiapoptotic signaling and transcriptional activity. (Review)
20876301 TRIP6 promotes Fas-mediated cell migration in apoptosis-resistant glioma cells. This effect is regulated via the Src-dependent phosphorylation of TRIP6 at Tyr-55.
19259951 IL-12 stimulates the OIP-1 gene expression through STAT-3 activation in CD4+ T cells.
19017743 TRIP6 overexpression in colon tumors suggests its critical role in cancer progression.
18348201 OIP-1 inhibits measles virus nucleocapsid protein induced pagetic osteoclast formation/activity through suppression of RANK signaling
17652164 ZRP-1 plays a crucial role in coupling the cell-matrix/cell-cell-contact signals with Rho GTPase-mediated actin remodeling by localizing at cell-matrix and cell-cell contact sites.
16624523 AMPK phosphorylated TRIP6 in vitro at the N-terminus and the transcriptional co-activator properties of TRIP6 were enhanced by AMPK action.
16240724 The TRIP6 knock-down led to an increased number of longer stress fibers and to the induction of locomotive phenotype in carcinoma cells.
16137684 Binding of LPP and TRIP6 to Scrib links Scrib to a communication pathway between cell-cell contacts and the nucleus, and implicates these zyxin family members in Scrib-associated functions.
15657077 The data establish a physical and functional association between TRIP6 and RIP2, and suggest that RIP2's involvement in multiple NF-kappaB and ERK activation pathways is mediated through TRIP6.
15148318 ZRP-1 has a role in endoglin regulation of cytoskeletal organization
15148318 Analysis of the subcellular distribution of ZRP-1 demonstrated that in the absence of endoglin, ZRP-1 mainly localizes to focal adhesion sites, whereas in the presence of endoglin ZRP-1 is found along actin stress fibers.
14688263 TRIP6 functions at a point of convergence between the activated LPA(2) receptor and downstream signals involved in cell adhesion and migration
11771657 the OIP-1 c-peptide is the functional domain of OIP-1

AA Sequence

MSGPTWLPPKQPEPARAPQGRAIPRGTPGPPPAHGAALQPHPRVNFCPLPSEQCYQAPGGPEDRGPAWVG      1 - 70
SHGVLQHTQGLPADRGGLRPGSLDAEIDLLSSTLAELNGGRGHASRRPDRQAYEPPPPPAYRTGSLKPNP     71 - 140
ASPLPASPYGGPTPASYTTASTPAGPAFPVQVKVAQPVRGCGPPRRGASQASGPLPGPHFPLPGRGEVWG    141 - 210
PGYRSQREPGPGAKEEAAGVSGPAGRGRGGEHGPQVPLSQPPEDELDRLTKKLVHDMNHPPSGEYFGQCG    211 - 280
GCGEDVVGDGAGVVALDRVFHVGCFVCSTCRAQLRGQHFYAVERRAYCEGCYVATLEKCATCSQPILDRI    281 - 350
LRAMGKAYHPGCFTCVVCHRGLDGIPFTVDATSQIHCIEDFHRKFAPRCSVCGGAIMPEPGQEETVRIVA    351 - 420
LDRSFHIGCYKCEECGLLLSSEGECQGCYPLDGHILCKACSAWRIQELSATVTTDC                  421 - 476
//

Text Mined References (56)

PMID Year Title
25673849 2015 Trip6 promotes dendritic morphogenesis through dephosphorylated GRIP1-dependent myosin VI and F-actin organization.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24033704 2013 The Zyxin-related protein thyroid receptor interacting protein 6 (TRIP6) is overexpressed in Ewing's sarcoma and promotes migration, invasion and cell growth.
23576104 2013 Characterization of TRIP6-dependent nasopharyngeal cancer cell migration.
23339869 2013 TRIP6 regulates p27 KIP1 to promote tumorigenesis.
23313295 2013 Gene expression profile of aquaporin 1 and associated interactors in malignant pleural mesothelioma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23088713 2012 Protein interactions of the transcription factor Hoxa1.
22990020 2012 Genome-wide association study for circulating levels of PAI-1 provides novel insights into its regulation.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22054418 2011 Defining the role of TRIP6 in cell physiology and cancer.
21689746 2011 TRIP6: an adaptor protein that regulates cell motility, antiapoptotic signaling and transcriptional activity.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21269460 2011 Initial characterization of the human central proteome.
20876301 2010 The adaptor protein TRIP6 antagonizes Fas-induced apoptosis but promotes its effect on cell migration.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19259951 2009 IL-12 stimulates the osteoclast inhibitory peptide-1 (OIP-1/hSca) gene expression in CD4+ T cells.
19060904 2009 An empirical framework for binary interactome mapping.
19017743 2009 TRIP6, a novel molecular partner of the MAGI-1 scaffolding molecule, promotes invasiveness.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18348201 2008 Osteoclast inhibitory peptide-1 (OIP-1) inhibits measles virus nucleocapsid protein stimulated osteoclast formation/activity.
17652164 2007 ZRP-1 controls Rho GTPase-mediated actin reorganization by localizing at cell-matrix and cell-cell adhesions.
17591779 2007 PTPL1/FAP-1 negatively regulates TRIP6 function in lysophosphatidic acid-induced cell migration.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17095609 2006 Salmonella typhimurium disseminates within its host by manipulating the motility of infected cells.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16880273 2006 Supervillin modulation of focal adhesions involving TRIP6/ZRP-1.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16624523 2006 TRIP6 transcriptional co-activator is a novel substrate of AMP-activated protein kinase.
16240724 [Down-regulation of TRIP6 expression induces actin cytoskeleton rearrangements in human carcinoma cell lines].
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16137684 2005 The tumor suppressor Scrib selectively interacts with specific members of the zyxin family of proteins.
15988003 2005 c-Src-mediated phosphorylation of TRIP6 regulates its function in lysophosphatidic acid-induced cell migration.
15657077 2005 TRIP6 is a RIP2-associated common signaling component of multiple NF-kappaB activation pathways.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15489293 2004 A nuclear isoform of the focal adhesion LIM-domain protein Trip6 integrates activating and repressing signals at AP-1- and NF-kappaB-regulated promoters.
15148318 2004 Endoglin regulates cytoskeletal organization through binding to ZRP-1, a member of the Lim family of proteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14688263 2004 TRIP6 enhances lysophosphatidic acid-induced cell migration by interacting with the lysophosphatidic acid 2 receptor.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12533418 2003 Novel RING finger protein OIP1 binds to conserved amino acid repeats in sperm tail protein ODF1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11782456 2002 Members of the Zyxin family of LIM proteins interact with members of the p130Cas family of signal transducers.
11771657 2002 Identification of the functional domain of osteoclast inhibitory peptide-1/hSca.
11336797 2001 LIM domain protein Trip6 has a conserved nuclear export signal, nuclear targeting sequences, and multiple transactivation domains.
11239002 2001 Comparative analysis of the gene-dense ACHE/TFR2 region on human chromosome 7q22 with the orthologous region on mouse chromosome 5.
10826496 2000 The zyxin-related protein TRIP6 interacts with PDZ motifs in the adaptor protein RIL and the protein tyrosine phosphatase PTP-BL.
10794523 1999 LIM domain-containing protein trip6 can act as a coactivator for the v-Rel transcription factor.
10400701 1999 ZRP-1, a zyxin-related protein, interacts with the second PDZ domain of the cytosolic protein tyrosine phosphatase hPTP1E.
9598321 1998 The human TRIP6 gene encodes a LIM domain protein and maps to chromosome 7q22, a region associated with tumorigenesis.
9466265 1998 Using the yeast two-hybrid system to identify human epithelial cell proteins that bind gonococcal Opa proteins: intracellular gonococci bind pyruvate kinase via their Opa proteins and require host pyruvate for growth.
7776974 1995 Two classes of proteins dependent on either the presence or absence of thyroid hormone for interaction with the thyroid hormone receptor.