Property Summary

NCBI Gene PubMed Count 11
PubMed Score 14.10
PubTator Score 3.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
active Crohn's disease 1.264 3.1e-02
adrenocortical carcinoma 1.688 8.1e-04
astrocytic glioma -2.500 4.1e-02
atypical teratoid / rhabdoid tumor 2.300 2.3e-05
Breast cancer 1.200 3.7e-07
breast carcinoma 1.100 1.0e-32
ductal carcinoma in situ 2.100 1.0e-05
ependymoma 1.500 2.1e-05
glioblastoma 1.300 1.1e-02
group 4 medulloblastoma 1.300 4.3e-02
intraductal papillary-mucinous neoplasm ... 1.700 4.8e-03
invasive ductal carcinoma 1.900 2.1e-03
lung adenocarcinoma 1.400 1.7e-07
non-small cell lung cancer 2.269 4.4e-24
oligodendroglioma -1.400 4.5e-07
osteosarcoma -2.144 8.9e-03
ovarian cancer 2.400 6.8e-04
pancreatic cancer 1.600 1.1e-06
subependymal giant cell astrocytoma -1.735 8.1e-03

Gene RIF (7)

AA Sequence

MHNFEEELTCPICYSIFEDPRVLPCSHTFCRNCLENILQASGNFYIWRPLRIPLKCPNCRSITEIAPTGI      1 - 70
ESLPVNFALRAIIEKYQQEDHPDIVTCPEHYRQPLNVYCLLDKKLVCGHCLTIGQHHGHPIDDLQSAYLK     71 - 140
EKDTPQKLLEQLTDTHWTDLTHLIEKLKEQKSHSEKMIQGDKEAVLQYFKELNDTLEQKKKSFLTALCDV    141 - 210
GNLINQEYTPQIERMKEIREQQLELMALTISLQEESPLKFLEKVDDVRQHVQILKQRPLPEVQPVEIYPR    211 - 280
VSKILKEEWSRTEIGQIKNVLIPKMKISPKRMSCSWPGKDEKEVEFLKILNIVVVTLISVILMSILFFNQ    281 - 350
HIITFLSEITLIWFSEASLSVYQSLSNSLHKVKNILCHIFYLLKEFVWKIVSH                     351 - 403
//

Text Mined References (13)

PMID Year Title