Property Summary

NCBI Gene PubMed Count 6
PubMed Score 15.85
PubTator Score 19.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
pancreatic cancer 1.300 1.6e-02
malignant mesothelioma -2.600 2.7e-06
tuberculosis 1.500 4.4e-03
group 3 medulloblastoma 2.600 7.8e-04
pancreatic carcinoma 1.300 1.6e-02
psoriasis 1.100 4.9e-20
facioscapulohumeral dystrophy 2.200 6.6e-03

 GO Component (1)

 GO Process (1)

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
18187620 Knockdown of tripartite motif containing 58 (TRIM58) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MAWAPPGERLREDARCPVCLDFLQEPVSVDCGHSFCLRCISEFCEKSDGAQGGVYACPQCRGPFRPSGFR      1 - 70
PNRQLAGLVESVRRLGLGAGPGARRCARHGEDLSRFCEEDEAALCWVCDAGPEHRTHRTAPLQEAAGSYQ     71 - 140
VKLQMALELMRKELEDALTQEANVGKKTVIWKEKVEMQRQRFRLEFEKHRGFLAQEEQRQLRRLEAEERA    141 - 210
TLQRLRESKSRLVQQSKALKELADELQERCQRPALGLLEGVRGVLSRSKAVTRLEAENIPMELKTACCIP    211 - 280
GRRELLRKFQVDVKLDPATAHPSLLLTADLRSVQDGEPWRDVPNNPERFDTWPCILGLQSFSSGRHYWEV    281 - 350
LVGEGAEWGLGVCQDTLPRKGETTPSPENGVWALWLLKGNEYMVLASPSVPLLQLESPRCIGIFLDYEAG    351 - 420
EISFYNVTDGSYIYTFNQLFSGLLRPYFFICDATPLILPPTTIAGSGNWASRDHLDPASDVRDDHL        421 - 486
//

Text Mined References (7)

PMID Year Title
25241935 2014 Trim58 degrades Dynein and regulates terminal erythropoiesis.
23222517 2012 Seventy-five genetic loci influencing the human red blood cell.
22139419 2011 New gene functions in megakaryopoiesis and platelet formation.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.