Property Summary

NCBI Gene PubMed Count 8
PubMed Score 30.51
PubTator Score 3.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
posterior fossa group B ependymoma 416 2.4e-10
osteosarcoma 7950 2.5e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Gout 106 0.0 3.0

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.352 2.5e-05
posterior fossa group B ependymoma -1.200 2.4e-10

AA Sequence

MAEGEDMQTFTSIMDALVRISTSMKNMEKELLCPVCQEMYKQPLVLPCTHNVCQACAREVLGQQGYIGHG      1 - 70
GDPSSEPTSPASTPSTRSPRLSRRTLPKPDRLDRLLKSGFGTYPGRKRGALHPQVIMFPCPACQGDVELG     71 - 140
ERGLAGLFRNLTLERVVERYRQSVSVGGAILCQLCKPPPLEATKGCTECRATFCNECFKLFHPWGTQKAQ    141 - 210
HEPTLPTLSFRPKGLMCPDHKEEVTHYCKTCQRLVCQLCRVRRTHSGHKITPVLSAYQALKDKLTKSLTY    211 - 280
ILGNQDTVQTQICELEEAVRHTEVSGQQAKEEVSQLVRGLGAVLEEKRASLLQAIEECQQERLARLSAQI    281 - 350
QEHRSLLDGSGLVGYAQEVLKETDQPCFVQAAKQLHNRIARATEALQTFRPAASSSFRHCQLDVGREMKL    351 - 420
LTELNFLRVPEAPVIDTQRTFAYDQIFLCWRLPPHSPPAWHYTVEFRRTDVPAQPGPTRWQRREEVRGTS    421 - 490
ALLENPDTGSVYVLRVRGCNKAGYGEYSEDVHLHTPPAPVLHFFLDSRWGASRERLAISKDQRAVRSVPG    491 - 560
LPLLLAADRLLTGCHLSVDVVLGDVAVTQGRSYWACAVDPASYLVKVGVGLESKLQESFQGAPDVISPRY    561 - 630
DPDSGHDSGAEDATVEASPPFAFLTIGMGKILLGSGASSNAGLTGRDGPTAGCTVPLPPRLGICLDYERG    631 - 700
RVSFLDAVSFRGLLECPLDCSGPVCPAFCFIGGGAVQLQEPVGTKPERKVTIGGFAKLD               701 - 759
//

Text Mined References (9)

PMID Year Title