Property Summary

NCBI Gene PubMed Count 22
PubMed Score 49.03
PubTator Score 13.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma -1.200 2.1e-05
atypical teratoid / rhabdoid tumor -1.100 1.9e-05
glioblastoma -1.100 3.0e-03
group 4 medulloblastoma -1.100 2.1e-05
Multiple myeloma 1.007 3.5e-03
ovarian cancer -1.300 2.8e-05

Synonym

Accession Q96DX7 D3DR14 Q96QY2 Q9UGK0
Symbols AN3
MC7
DIPB
HSA249128

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (11)

AA Sequence

MASGVGAAFEELPHDGTCDECEPDEAPGAEEVCRECGFCYCRRHAEAHRQKFLSHHLAEYVHGSQAWTPP      1 - 70
ADGEGAGKEEAEVKVEQEREIESEAGEESESEEESESEEESETEEESEDESDEESEEDSEEEMEDEQESE     71 - 140
AEEDNQEEGESEAEGETEAESEFDPEIEMEAERVAKRKCPDHGLDLSTYCQEDRQLICVLCPVIGAHQGH    141 - 210
QLSTLDEAFEELRSKDSGGLKAAMIELVERLKFKSSDPKVTRDQMKMFIQQEFKKVQKVIADEEQKALHL    211 - 280
VDIQEAMATAHVTEILADIQSHMDRLMTQMAQAKEQLDTSNESAEPKAEGDEEGPSGASEEEDT          281 - 344
//

Text Mined References (23)

PMID Year Title