Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.70
PubTator Score 0.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Dermatitis, Irritant 9 0.0 0.0
Disease Target Count P-value
psoriasis 6694 1.5e-15
ulcerative colitis 1819 6.3e-04
diabetes mellitus 1728 1.3e-03
Disease Target Count Z-score Confidence
Irritant dermatitis 9 3.656 1.8

Expression

  Differential Expression (3)

Disease log2 FC p
diabetes mellitus 1.400 1.3e-03
psoriasis 2.800 1.5e-15
ulcerative colitis 2.000 6.3e-04

Gene RIF (3)

AA Sequence

MIPLQKDNQEEGVCPICQESLKEAVSTNCGHLFCRVCLTQHVEKASASGVFCCPLCRKPCSEEVLGTGYI      1 - 70
CPNHQKRVCRFCEESRLLLCVECLVSPEHMSHHELTIENALSHYKERLNRRSRKLRKDIAELQRLKAQQE     71 - 140
KKLQALQFQVDHGNHRLEAGPESQHQTREQLGALPQQWLGQLEHMPAEAARILDISRAVTQLRSLVIDLE    141 - 210
RTAKELDTNTLKNAGDLLNRSAPQKLEVIYPQLEKGVSELLLQPPQKL                          211 - 258
//

Text Mined References (9)

PMID Year Title