Property Summary

NCBI Gene PubMed Count 9
PubMed Score 11.67
PubTator Score 7.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
malignant mesothelioma -2.100 8.1e-08
astrocytic glioma -2.700 4.5e-03
ependymoma -1.700 4.5e-02
oligodendroglioma -2.400 1.6e-02
psoriasis -1.800 1.9e-03
glioblastoma multiforme -1.300 4.4e-15
adrenocortical carcinoma 1.134 2.8e-02
tuberculosis -2.400 9.6e-08
intraductal papillary-mucinous carcinoma... 1.900 2.1e-03
intraductal papillary-mucinous neoplasm ... 2.700 3.2e-04
lung cancer -1.400 9.8e-03
group 3 medulloblastoma 2.600 1.5e-04
pilocytic astrocytoma -2.800 2.5e-07
severe Alzheimer's disease -1.427 3.1e-02
Pick disease -1.500 1.7e-02
ductal carcinoma in situ 1.500 4.4e-02
ulcerative colitis -2.100 1.1e-05

Gene RIF (5)

PMID Text
23333304 HIV-1 Vif downregulates the expression of tripartite motif containing 36 (TRIM36) in Vif-expression T cells
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19232519 TRIM36 has a ubiquitin ligase activity and interacts with centromere protein-H, potentially associated with chromosome segregation and its excess may cause chromosomal instability.
15955891 molecular cloning and characterization of a human haprin ortholog.
15145053 The overexpression of the TRIM36 in the vast majority of prostate cancer suggest that this gene might be involved in the prostate tumorigenesis.

AA Sequence

MSESGEMSEFGYIMELIAKGKVTIKNIERELICPACKELFTHPLILPCQHSICHKCVKELLLTLDDSFND      1 - 70
VGSDNSNQSSPRLRLPSPSMDKIDRINRPGWKRNSLTPRTTVFPCPGCEHDVDLGERGINGLFRNFTLET     71 - 140
IVERYRQAARAATAIMCDLCKPPPQESTKSCMDCSASYCNECFKIHHPWGTIKAQHEYVGPTTNFRPKIL    141 - 210
MCPEHETERINMYCELCRRPVCHLCKLGGNHANHRVTTMSSAYKTLKEKLSKDIDYLIGKESQVKSQISE    211 - 280
LNLLMKETECNGERAKEEAITHFEKLFEVLEERKSSVLKAIDSSKKLRLDKFQTQMEEYQGLLENNGLVG    281 - 350
YAQEVLKETDQSCFVQTAKQLHLRIQKATESLKSFRPAAQTSFEDYVVNTSKQTELLGELSFFSSGIDVP    351 - 420
EINEEQSKVYNNALINWHHPEKDKADSYVLEYRKINRDDEMSWNEIEVCGTSKIIQDLENSSTYAFRVRA    421 - 490
YKGSICSPCSRELILHTPPAPVFSFLFDEKCGYNNEHLLLNLKRDRVESRAGFNLLLAAERIQVGYYTSL    491 - 560
DYIIGDTGITKGKHFWAFRVEPYSYLVKVGVASSDKLQEWLRSPRDAVSPRYEQDSGHDSGSEDACFDSS    561 - 630
QPFTLVTIGMQKFFIPKSPTSSNEPENRVLPMPTSIGIFLDCDKGKVDFYDMDQMKCLYERQVDCSHTLY    631 - 700
PAFALMGSGGIQLEEPITAKYLEYQEDM                                              701 - 728
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19232519 2009 TRIM36 interacts with the kinetochore protein CENP-H and delays cell cycle progression.
19028597 2009 Maturation of human dendritic cells is accompanied by functional remodelling of the ubiquitin-proteasome system.
15955891 Identification of human HAPRIN potentially involved in the acrosome reaction.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15145053 2004 Cloning and characterisation of the RBCC728/TRIM36 zinc-binding protein from the tumor suppressor gene region at chromosome 5q22.3.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11331580 2001 The tripartite motif family identifies cell compartments.