Property Summary

NCBI Gene PubMed Count 48
PubMed Score 28.49
PubTator Score 32.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma 2.900 1.0e-07
esophageal adenocarcinoma -3.100 2.5e-02
osteosarcoma 1.405 3.6e-06
posterior fossa group A ependymoma 2.100 4.2e-09
medulloblastoma, large-cell 1.200 2.9e-04
primary pancreatic ductal adenocarcinoma 2.137 3.1e-02
non-small cell lung cancer 3.658 1.4e-11
intraductal papillary-mucinous neoplasm ... 3.100 9.8e-04
colon cancer 3.500 5.4e-04
active Crohn's disease 1.217 7.8e-03
active ulcerative colitis 3.315 2.4e-02
pancreatic cancer 3.700 9.7e-09
interstitial cystitis -3.700 1.3e-04
Breast cancer -3.300 4.2e-13
breast carcinoma -1.800 3.4e-19
spina bifida -1.997 4.1e-02
ovarian cancer 1.500 2.7e-04
pituitary cancer -2.000 7.1e-07

Gene RIF (27)

PMID Text
26471361 Findings established a role for ATDC/TRIM29 as a robust pathogenic driver of bladder cancer development, identified downstream effector pathways, and implicated ATDC as a candidate biomarker and therapeutic target.
26381412 define a novel function for ATDC in the RNF8-mediated DNA damage response and implicate RNF8 binding as a key determinant of the radioprotective function of ATDC
26191199 Results suggest that TRIM29 functions as an oncogene in gastric cancer and is regulated by miR-185.
26095369 TRIM29 functions as a scaffold protein to assemble DNA repair proteins into chromatin followed by efficient activation of DNA damage response.
26071105 These findings suggest that TRIM29 regulates the p63-mediated pathway and the behavior of cervical cancer cells.
25491629 Down-regulation of ATDC inhibits the growth and proliferation of esophageal carcinoma cells.
24950909 TWIST1 inhibited TRIM29 promoter activity.
24864129 TRIM29 promotes tumor progression and may be a novel prognostic marker for pancreatic ductal adenocarcinoma.
24485335 TRIM29 may be useful marker for distinguishing prostate cancers from benign tissues
24469230 Ataxia-telangiectasia group D-associated gene (ATDC) mediates resistance to ionizing radiation.
24078150 Down-regulation of TRIM29 inhibited tumor cell proliferation in vitro.
23201130 the expression of cyclin D1, MCM7, TRIM29, and UBE2C was found to be significantly associated with progression to muscle-invasive bladder cancer.
23020249 ATDC mRNA and protein expression were significantly higher in esophageal squamous cell carcinoma tissue than in matched noncancerous tissues.
22721621 The interaction between TRIM29 and beta-catenin may participate in the development of lung squamous cell carcinoma.
22490895 The expressions of TrkB and TRIM29 are correlated with lymph node metastasis in gastric cancer.
22138580 results suggest that loss of TRIM29 expression in normal breast luminal cells can contribute to malignant transformation and lead to progression of ER+ breast cancer in premenopausal women.
21463657 Data show that overexpression of TRIM29 promoted degradation and changed localization of Tip60 and reduced acetylation of p53 at lysine 120 by Tip60, resulting in enhancement of cell growth and transforming activity.
20947501 Histone deacetylase 9 (HDAC9) regulates the functions of the ATDC (TRIM29) protein
20454669 TRIM29 allows keratinocytes to enter a protective alternative differentiation process rather than die massively after stress.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20368352 ATDC increases cell proliferation via inhibition of p53 nuclear activities.
20083228 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19430419 the percentage of lung carcinoma patients remaining unclassifiable by TTF-1/TP63 was twice that of the five-antibody (TRIM29, CEACAM5, SLC7A5, MUC1, and CK5/6) test
19249679 ATDC was found to stabilize beta-catenin via ATDC-induced effects on the Disheveled-2 protein, a negative regulator of glycogen synthase kinase 3beta in the Wnt/beta-catenin signaling pathway.
18854154 Knockdown of tripartite motif containing 29 (TRIM29) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
17448597 TRIM29 is upregulated after radical prostatectomy for prostatic neoplasms.
16890201 suppressed ATDC expression is associated with malignant phenotype.

AA Sequence

MEAADASRSNGSSPEARDARSPSGPSGSLENGTKADGKDAKTTNGHGGEAAEGKSLGSALKPGEGRSALF      1 - 70
AGNEWRRPIIQFVESGDDKNSNYFSMDSMEGKRSPYAGLQLGAAKKPPVTFAEKGELRKSIFSESRKPTV     71 - 140
SIMEPGETRRNSYPRADTGLFSRSKSGSEEVLCDSCIGNKQKAVKSCLVCQASFCELHLKPHLEGAAFRD    141 - 210
HQLLEPIRDFEARKCPVHGKTMELFCQTDQTCICYLCMFQEHKNHSTVTVEEAKAEKETELSLQKEQLQL    211 - 280
KIIEIEDEAEKWQKEKDRIKSFTTNEKAILEQNFRDLVRDLEKQKEEVRAALEQREQDAVDQVKVIMDAL    281 - 350
DERAKVLHEDKQTREQLHSISDSVLFLQEFGALMSNYSLPPPLPTYHVLLEGEGLGQSLGNFKDDLLNVC    351 - 420
MRHVEKMCKADLSRNFIERNHMENGGDHRYVNNYTNSFGGEWSAPDTMKRYSMYLTPKGGVRTSYQPSSP    421 - 490
GRFTKETTQKNFNNLYGTKGNYTSRVWEYSSSIQNSDNDLPVVQGSSSFSLKGYPSLMRSQSPKAQPQTW    491 - 560
KSGKQTMLSHYRPFYVNKGNGIGSNEAP                                              561 - 588
//

Text Mined References (54)

PMID Year Title
26471361 2015 ATDC/TRIM29 Drives Invasive Bladder Cancer Formation through miRNA-Mediated and Epigenetic Mechanisms.
26381412 2015 ATDC (Ataxia Telangiectasia Group D Complementing) Promotes Radioresistance through an Interaction with the RNF8 Ubiquitin Ligase.
26191199 2015 TRIM29 functions as an oncogene in gastric cancer and is regulated by miR-185.
26095369 2015 TRIM29 regulates the assembly of DNA repair proteins into damaged chromatin.
26071105 2015 TRIM29 regulates the p63-mediated pathway in cervical cancer cells.
25491629 2014 Down-regulating ATDC inhibits the proliferation of esophageal carcinoma cells.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
24950909 2014 TRIM29 suppresses TWIST1 and invasive breast cancer behavior.
24864129 2014 TRIM29 as a novel biomarker in pancreatic adenocarcinoma.
24485335 2014 TRIM29 as a novel prostate basal cell marker for diagnosis of prostate cancer.
24469230 2014 ATDC/TRIM29 phosphorylation by ATM/MAPKAP kinase 2 mediates radioresistance in pancreatic cancer cells.
24078150 2013 Up-regulation of tripartite motif-containing 29 promotes cancer cell proliferation and predicts poor survival in colorectal cancer.
23201130 2013 Multicenter validation of cyclin D1, MCM7, TRIM29, and UBE2C as prognostic protein markers in non-muscle-invasive bladder cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23020249 Upregulated ataxia-telangiectasia group D complementing gene correlates with poor prognosis in patients with esophageal squamous cell carcinoma.
22990015 2012 A genome-wide association study identifies a gene network of ADAMTS genes in the predisposition to pediatric stroke.
22969067 2012 Genetic variants near PDGFRA are associated with corneal curvature in Australians.
22721621 2012 Significance of TRIM29 and ?-catenin expression in non-small-cell lung cancer.
22490895 2012 [Predicative value of expression of TrkB and TRIM29 in biopsy tissues from preoperative gastroscopy in lymph node metastasis of gastric cancer].
22138580 2012 TRIM29 functions as a tumor suppressor in nontumorigenic breast cells and invasive ER+ breast cancer.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21463657 2011 TRIM29 negatively regulates p53 via inhibition of Tip60.
21269460 2011 Initial characterization of the human central proteome.
20947501 2010 Histone deacetylase 9 (HDAC9) regulates the functions of the ATDC (TRIM29) protein.
20454669 2010 Proteomic profiling of human keratinocytes undergoing UVB-induced alternative differentiation reveals TRIpartite Motif Protein 29 as a survival factor.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20368352 2010 The ATDC (TRIM29) protein binds p53 and antagonizes p53-mediated functions.
20083228 2010 Genome-wide analysis of chromosomal alterations in patients with esophageal squamous cell carcinoma exposed to tobacco and betel quid from high-risk area in India.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19430419 2009 A novel five-antibody immunohistochemical test for subclassification of lung carcinoma.
19249679 2009 Oncogenic function of ATDC in pancreatic cancer through Wnt pathway activation and beta-catenin stabilization.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17562024 2007 Large-scale identification of human genes implicated in epidermal barrier function.
17448597 2008 Marked gene transcript level alterations occur early during radical prostatectomy.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16890201 2006 Suppression of anchorage-independent growth by expression of the ataxia-telangiectasia group D complementing gene, ATDC.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11331580 2001 The tripartite motif family identifies cell compartments.
10719033 2000 Altered splicing of the ATDC message in ataxia telangiectasia group D cells results in the absence of a functional protein.
8647648 1996 Expression of the ATDC (ataxia telangiectasia group D-complementing) gene in A431 human squamous carcinoma cells.
8406440 1993 A radiation hybrid map of human chromosome 11q22-q23 containing the ataxia-telangiectasia disease locus.
8188213 1994 Nucleotide sequence analysis of a candidate gene for ataxia-telangiectasia group D (ATDC).
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7836856 1994 Expression of the candidate A-T gene ATDC is not detectable in a human cell line with a normal response to ionizing radiation.
7644499 1995 The product of the ataxia-telangiectasia group D complementing gene, ATDC, interacts with a protein kinase C substrate and inhibitor.
7530755 1994 Expression of a candidate ataxia-telangiectasia group D gene in cultured fibroblast cell lines and human tissues.
1609804 1992 Cloning of a candidate gene for ataxia-telangiectasia group D.