Property Summary

NCBI Gene PubMed Count 21
PubMed Score 7.20
PubTator Score 7.55

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.200 2.5e-02

Synonym

Accession Q12899 A6NG96 Q5SRL2
Symbols AFP
RNF95
ZNF173

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA Inparanoid

Gene RIF (6)

PMID Text
26043685 Down-regulation of TRIM26 is associated with worse prognosis of hepatocellular carcinoma.
22433715 In addition to confirming one of the top findings in the meta-analysis, TRIM26, RNF5 and HLA-DRB3 have been identified as potential candidate genes for schizophrenia.
22294275 The study reports no associations between polymorphisms in TRIM26 and the risk of aspirin-exacerbated respiratory disease in both logistic and regression analyses.
20593013 Observational study of gene-disease association. (HuGE Navigator)
19851445 Observational study of gene-disease association. (HuGE Navigator)
17713163 Higher baseline serum AFP levels independently predicted a lower sustained viral response to antivirals among patients with chronic hepatitis C.

AA Sequence

MATSAPLRSLEEEVTCSICLDYLRDPVTIDCGHVFCRSCTTDVRPISGSRPVCPLCKKPFKKENIRPVWQ      1 - 70
LASLVENIERLKVDKGRQPGEVTREQQDAKLCERHREKLHYYCEDDGKLLCVMCRESREHRPHTAVLMEK     71 - 140
AAQPHREKILNHLSTLRRDRDKIQGFQAKGEADILAALKKLQDQRQYIVAEFEQGHQFLREREEHLLEQL    141 - 210
AKLEQELTEGREKFKSRGVGELARLALVISELEGKAQQPAAELMQDTRDFLNRYPRKKFWVGKPIARVVK    211 - 280
KKTGEFSDKLLSLQRGLREFQGKLLRDLEYKTVSVTLDPQSASGYLQLSEDWKCVTYTSLYKSAYLHPQQ    281 - 350
FDCEPGVLGSKGFTWGKVYWEVEVEREGWSEDEEEGDEEEEGEEEEEEEEAGYGDGYDDWETDEDEESLG    351 - 420
DEEEEEEEEEEEVLESCMVGVARDSVKRKGDLSLRPEDGVWALRLSSSGIWANTSPEAELFPALRPRRVG    421 - 490
IALDYEGGTVTFTNAESQELIYTFTATFTRRLVPFLWLKWPGTRLLLRP                         491 - 539
//

Text Mined References (23)

PMID Year Title
26043685 2015 TRIM26 functions as a novel tumor suppressor of hepatocellular carcinoma and its downregulation contributes to worse prognosis.
25416956 2014 A proteome-scale map of the human interactome network.
24489884 2014 Genome-wide association study of proneness to anger.
23453885 2013 Identification of risk loci with shared effects on five major psychiatric disorders: a genome-wide analysis.
23077300 2013 TRIM protein-mediated regulation of inflammatory and innate immune signaling and its association with antiretroviral activity.
22883433 2012 Genome-wide association study implicates HLA-C*01:02 as a risk factor at the major histocompatibility complex locus in schizophrenia.
22433715 2012 Expression QTL analysis of top loci from GWAS meta-analysis highlights additional schizophrenia candidate genes.
22294275 2012 Association study between TRIM26 polymorphisms and risk of aspirin-exacerbated respiratory disease.
21926974 2011 Genome-wide association study identifies five new schizophrenia loci.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20593013 2010 A major histocompatibility Class I locus contributes to multiple sclerosis susceptibility independently from HLA-DRB1*15:01.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
18248090 2008 TRIM E3 ligases interfere with early and late stages of the retroviral life cycle.
17713163 2007 Serum alpha-foetoprotein level predicts treatment outcome in chronic hepatitis C.
16702430 2006 Rapid evolution of major histocompatibility complex class I genes in primates generates new disease alleles in humans via hitchhiking diversity.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11331580 2001 The tripartite motif family identifies cell compartments.
9624122 1998 Two kinesin light chain genes in mice. Identification and characterization of the encoded proteins.
8530076 1995 Cloning of a new "finger" protein gene (ZNF173) within the class I region of the human MHC.