Property Summary

NCBI Gene PubMed Count 16
PubMed Score 31.88
PubTator Score 13.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Rheumatoid Arthritis 1.300 1.3e-02
osteosarcoma -1.165 2.8e-03
tuberculosis and treatment for 6 months 1.100 4.8e-05
intraductal papillary-mucinous carcinoma... 1.100 1.2e-03
inflammatory breast cancer 1.100 2.4e-02

Gene RIF (11)

PMID Text
25105968 TRIM11 is a host cellular factor that interferes with the early steps of HIV-1 replication and provides a connection between viral protein and host antiviral factors.
25105968 HIV-1 Vpr may indirectly regulate TRIM11 in a dose-dependent manner, which is independent of the ubiquitin system or VprBP-mediated pathway
23675467 TRIM11 negatively regulates IFN-beta production and antiviral activity by targeting TBK1.
23178488 TRIM11 is overexpressed in high-grade gliomas and promotes proliferation, invasion, migration and glial tumor growth.
22307522 Study shows that the E3 ubiquitin ligase TRIM11 plays a critical role in the clearance of mutant PHOX2B, which causes congenital central hypoventilation syndrome, through the proteasome.
19472918 Observational study of gene-disease association. (HuGE Navigator)
18275850 This study suggests a potential role for Trim11 in the specification of NA phenotype by interaction with Phox2b.
18248090 Downregulation of TRIM11 and TRIM15 enhanced virus release suggesting that these proteins contribute to the endogenous restriction of retroviruses in cells.
18248090 HIV-1 Vpr may indirectly regulate TRIM11 in a dose-dependent manner, which is independent of the ubiquitin system or VprBP-mediated pathway
16904669 These results suggest that TRIM11, with the ubiquitin-proteasome pathway, regulates ARC105 function in TGFbeta signaling.
16098226 PAX6 interacts with HOMER3, DNCL1, and TRIM11. Three C-terminal PAX6 mutations, previously identified in patients with eye malformations, all reduced or abolished the interactions.

AA Sequence

MAAPDLSTNLQEEATCAICLDYFTDPVMTDCGHNFCRECIRRCWGQPEGPYACPECRELSPQRNLRPNRP      1 - 70
LAKMAEMARRLHPPSPVPQGVCPAHREPLAAFCGDELRLLCAACERSGEHWAHRVRPLQDAAEDLKAKLE     71 - 140
KSLEHLRKQMQDALLFQAQADETCVLWQKMVESQRQNVLGEFERLRRLLAEEEQQLLQRLEEEELEVLPR    141 - 210
LREGAAHLGQQSAHLAELIAELEGRCQLPALGLLQDIKDALRRVQDVKLQPPEVVPMELRTVCRVPGLVE    211 - 280
TLRRFRGDVTLDPDTANPELILSEDRRSVQRGDLRQALPDSPERFDPGPCVLGQERFTSGRHYWEVEVGD    281 - 350
RTSWALGVCRENVNRKEKGELSAGNGFWILVFLGSYYNSSERALAPLRDPPRRVGIFLDYEAGHLSFYSA    351 - 420
TDGSLLFIFPEIPFSGTLRPLFSPLSSSPTPMTICRPKGGSGDTLAPQ                          421 - 468
//

Text Mined References (18)

PMID Year Title
25271088 2015 Gene by stress genome-wide interaction analysis and path analysis identify EBF1 as a cardiovascular and metabolic risk gene.
25105968 2014 The human antiviral factor TRIM11 is under the regulation of HIV-1 Vpr.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23675467 2013 TRIM11 negatively regulates IFN? production and antiviral activity by targeting TBK1.
23178488 2013 TRIM11 is overexpressed in high-grade gliomas and promotes proliferation, invasion, migration and glial tumor growth.
22307522 2012 The E3 ubiquitin ligase TRIM11 mediates the degradation of congenital central hypoventilation syndrome-associated polyalanine-expanded PHOX2B.
19472918 2008 Candidate-gene testing for orphan limb-girdle muscular dystrophies.
18275850 2008 Trim11 increases expression of dopamine beta-hydroxylase gene by interacting with Phox2b.
18248090 2008 TRIM E3 ligases interfere with early and late stages of the retroviral life cycle.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16904669 2006 TRIM11 binds to and destabilizes a key component of the activator-mediated cofactor complex (ARC105) through the ubiquitin-proteasome system.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16098226 2005 A screen for proteins that interact with PAX6: C-terminal mutations disrupt interaction with HOMER3, DNCL1 and TRIM11.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12670303 2003 A tripartite motif protein TRIM11 binds and destabilizes Humanin, a neuroprotective peptide against Alzheimer's disease-relevant insults.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11331580 2001 The tripartite motif family identifies cell compartments.