Property Summary

NCBI Gene PubMed Count 13
PubMed Score 245.08
PubTator Score 17.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.173 1.9e-02
Multiple myeloma 1.956 2.5e-04
astrocytic glioma -1.400 2.9e-02
glioblastoma 1.300 1.5e-03
lung cancer 1.900 8.2e-05
Breast cancer 2.800 2.6e-02
group 3 medulloblastoma 1.100 5.7e-03
ovarian cancer 1.700 1.8e-04

 GO Function (1)

Gene RIF (9)

PMID Text
26071602 crystal structures of free TRIAP1 and TRIAP1-SLMO1 complex reveal how the PRELI domain is chaperoned during import into the intermembrane mitochondrial space; structural resemblance of PRELI-like domain of SLMO1 with that of mammalian phoshatidylinositol transfer proteins suggest they share similar lipid transfer mechanisms
25998939 Results describe the upregulation of TRIAP1 in drugresistant breast cancer cells. Its experimental modulation changed breast tumor cells sensitivity to doxorubicin, thus confirming its role in drug resistance.
23931759 Loss of TRIAP1 or PRELI impairs the accumulation of Cardiolipin, facilitates the release of cytochrome c, and renders cells vulnerable to apoptosis upon intrinsic and extrinsic stimulation.
23684607 TRIAP1 is Conserved Specific Coregulators of the p21:PUMA Expression Ratio.
20877624 Observational study of gene-disease association. (HuGE Navigator)
19171422 Upregulated in at least 50% of multiple myeloma cases tested.
15735665 HSPC132 is p53CSV, a novel p53-inducible gene involved in the p53-dependent cell-survival pathway
15735003 Under specific conditions of stress, p53 regulates transcription of p53CSV and that p53CSV is one of the important players in the p53-mediated cell survival.
15735003 HSPC132 is p53CSV, a novel p53-inducible gene involved in the p53-dependent cell-survival pathway

AA Sequence

MNSVGEACTDMKREYDQCFNRWFAEKFLKGDSSGDPCTDLFKRYQQCVQKAIKEKEIPIEGLEFMGHGKE      1 - 70
KPENSS                                                                     71 - 76
//

Text Mined References (18)

PMID Year Title
26071602 2015 Structural insight into the TRIAP1/PRELI-like domain family of mitochondrial phospholipid transfer complexes.
25998939 2015 Apoptosis inhibitor TRIAP1 is a novel effector of drug resistance.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23931759 2013 TRIAP1/PRELI complexes prevent apoptosis by mediating intramitochondrial transport of phosphatidic acid.
23684607 2013 A genetic screen identifies TCF3/E2A and TRIAP1 as pathway-specific regulators of the cellular response to p53 activation.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21901158 2011 Genome-wide detection of allele specific copy number variation associated with insulin resistance in African Americans from the HyperGEN study.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19171422 2009 SAGE analysis highlights the importance of p53csv, ddx5, mapkapk2 and ranbp2 to multiple myeloma tumorigenesis.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16541075 2006 The finished DNA sequence of human chromosome 12.
15735003 2005 p53CSV, a novel p53-inducible gene involved in the p53-dependent cell-survival pathway.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.