Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.87
PubTator Score 2.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 1.9e-06
ovarian cancer 8520 4.0e-05
osteosarcoma 7950 6.2e-04
diabetes mellitus 1728 1.6e-03
Disease Target Count Z-score Confidence
Ankylosing spondylitis 140 0.0 3.0

Expression

  Differential Expression (4)

Disease log2 FC p
diabetes mellitus 1.200 1.6e-03
osteosarcoma -1.013 6.2e-04
ovarian cancer -1.100 4.0e-05
psoriasis 2.400 1.9e-06

Gene RIF (2)

AA Sequence

MAWGGVHTCCFHLCCCCSWPQGAVPEELHKHPGQTLLLQCQYSPKRGPYQPKSWCQQTSPSRCTLLVTSS      1 - 70
KPWTAVQKSHYTIWDKPNAGFFNITMIQLTQNDSGFYWCGIYNASENIITVLRNISLVVSPAPTTSPMWT     71 - 140
LPWLPTSTVLITSPEGTSGHPSINGSETRKSRAPACLGSGGPRFLVLVLCGLLLAKGLML              141 - 200
//

Text Mined References (8)

PMID Year Title