Property Summary

NCBI Gene PubMed Count 24
PubMed Score 17.96
PubTator Score 120.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (2)

Disease log2 FC p
group 3 medulloblastoma 1.700 7.9e-05
lung adenocarcinoma 1.300 2.6e-07

 OMIM Phenotype (1)

Gene RIF (15)

AA Sequence

MPIRALCTICSDFFDHSRDVAAIHCGHTFHLQCLIQWFETAPSRTCPQCRIQVGKRTIINKLFFDLAQEE      1 - 70
ENVLDAEFLKNELDNVRAQLSQKDKEKRDSQVIIDTLRDTLEERNATVVSLQQALGKAEMLCSTLKKQMK     71 - 140
YLEQQQDETKQAQEEARRLRSKMKTMEQIELLLQSQRPEVEEMIRDMGVGQSAVEQLAVYCVSLKKEYEN    141 - 210
LKEARKASGEVADKLRKDLFSSRSKLQTVYSELDQAKLELKSAQKDLQSADKEIMSLKKKLTMLQETLNL    211 - 280
PPVASETVDRLVLESPAPVEVNLKLRRPSFRDDIDLNATFDVDTPPARPSSSQHGYYEKLCLEKSHSPIQ    281 - 350
DVPKKICKGPRKESQLSLGGQSCAGEPDEELVGAFPIFVRNAILGQKQPKRPRSESSCSKDVVRTGFDGL    351 - 420
GGRTKFIQPTDTVMIRPLPVKPKTKVKQRVRVKTVPSLFQAKLDTFLWS                         421 - 469
//

Text Mined References (27)

PMID Year Title