Property Summary

NCBI Gene PubMed Count 66
PubMed Score 54.41
PubTator Score 40.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Astrocytoma, Pilocytic 1.800 3.3e-07
atypical teratoid / rhabdoid tumor 1.300 1.9e-06
ductal carcinoma in situ 2.000 1.4e-03
glioblastoma 1.300 3.5e-04
group 3 medulloblastoma 1.200 3.8e-03
intraductal papillary-mucinous neoplasm ... 1.100 2.2e-02
invasive ductal carcinoma 2.000 1.0e-02
lung adenocarcinoma 1.300 6.2e-10
medulloblastoma, large-cell 1.900 2.0e-06
oligodendroglioma 1.200 1.8e-11
osteosarcoma 1.262 4.5e-04
ovarian cancer 1.100 1.9e-09
pediatric high grade glioma 1.400 8.7e-05
primitive neuroectodermal tumor 1.600 3.5e-03

Gene RIF (43)

AA Sequence

MPGFDYKFLEKPKRRLLCPLCGKPMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQLPLDYAKIYPDP      1 - 70
ELEVQVLGLPIRCIHSEEGCRWSGPLRHLQGHLNTCSFNVIPCPNRCPMKLSRRDLPAHLQHDCPKRRLK     71 - 140
CEFCGCDFSGEAYESHEGMCPQESVYCENKCGARMMRRLLAQHATSECPKRTQPCTYCTKEFVFDTIQSH    141 - 210
QYQCPRLPVACPNQCGVGTVAREDLPGHLKDSCNTALVLCPFKDSGCKHRCPKLAMARHVEESVKPHLAM    211 - 280
MCALVSRQRQELQELRRELEELSVGSDGVLIWKIGSYGRRLQEAKAKPNLECFSPAFYTHKYGYKLQVSA    281 - 350
FLNGNGSGEGTHLSLYIRVLPGAFDNLLEWPFARRVTFSLLDQSDPGLAKPQHVTETFHPDPNWKNFQKP    351 - 420
GTWRGSLDESSLGFGYPKFISHQDIRKRNYVRDDAVFIRAAVELPRKILS                        421 - 470
//

Text Mined References (71)

PMID Year Title