Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.66
PubTator Score 3.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
gastric cancer 1.600 2.2e-03
hepatocellular carcinoma 1.300 1.3e-03
pancreatic cancer 1.200 1.4e-02
Waldenstrons macroglobulinemia -1.353 1.7e-02
cutaneous lupus erythematosus 2.100 7.5e-04
osteosarcoma -4.079 2.1e-05
tuberculosis 1.700 4.7e-05
intraductal papillary-mucinous carcinoma... -1.400 1.0e-02
colon cancer -1.800 4.9e-02
lung cancer -2.100 2.0e-04
sarcoidosis 1.100 3.1e-02
interstitial cystitis 2.300 3.3e-03
adult high grade glioma 1.500 7.9e-04
pilocytic astrocytoma 1.500 5.2e-07
primary Sjogren syndrome 2.400 4.1e-04
pancreatic carcinoma 1.200 1.4e-02
psoriasis 1.100 3.7e-05
lung carcinoma -1.600 3.3e-20
ductal carcinoma in situ 1.300 1.7e-02
ulcerative colitis 1.400 4.9e-03
head and neck cancer -1.100 2.4e-02

Gene RIF (5)

PMID Text
23333304 HIV-1 Vif downregulates the expression of TRAF3 interacting protein 3 (TRAF3IP3) in Vif-expression T cells
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17868742 TRAF3IP3 stimulated cell growth by modulating the c-Jun N-terminal kinase (JNK) pathway
17277885 TRAF3 interacts with Smac/DIABLO via TRAF domain, leading to an increased proapoptotic effect of Smac/DIABLO in cytoplasm.
14572659 This paper provides an alignment of the mouse and human proteins.

AA Sequence

MISPDPRPSPGLARWAESYEAKCERRQEIRESRRCRPNVTTCRQVGKTLRIQQREQLQRARLQQFFRRRN      1 - 70
LELEEKGKAQHPQAREQGPSRRPGQVTVLKEPLSCARRISSPREQVTGTSSEVFPAQHPPPSGICRDLSD     71 - 140
HLSSQAGGLPPQDTPIKKPPKHHRGTQTKAEGPTIKNDASQQTNYGVAVLDKEIIQLSDYLKEALQRELV    141 - 210
LKQKMVILQDLLSTLIQASDSSWKGQLNEDKLKGKLRSLENQLYTCTQKYSPWGMKKVLLEMEDQKNSYE    211 - 280
QKAKESLQKVLEEKMNAEQQLQSTQRSLALAEQKCEEWRSQYEALKEDWRTLGTQHRELESQLHVLQSKL    281 - 350
QGADSRDLQMNQALRFLENEHQQLQAKIECLQGDRDLCSLDTQDLQDQLKRSEAEKLTLVTRVQQLQGLL    351 - 420
QNQSLQLQEQEKLLTKKDQALPVWSPKSFPNEVEPEGTGKEKDWDLRDQLQKKTLQLQAKEKECRELHSE    421 - 490
LDNLSDEYLSCLRKLQHCREELNQSQQLPPRRQCGRWLPVLMVVIAAALAVFLANKDNLMI             491 - 551
//

Text Mined References (13)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18782753 2009 A PP2A phosphatase high density interaction network identifies a novel striatin-interacting phosphatase and kinase complex linked to the cerebral cavernous malformation 3 (CCM3) protein.
17868742 2007 Identification of five human novel genes associated with cell proliferation by cell-based screening from an expressed cDNA ORF library.
17203973 2007 The proteomic reactor facilitates the analysis of affinity-purified proteins by mass spectrometry: application for identifying ubiquitinated proteins in human cells.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14572659 2003 T3JAM, a novel protein that specifically interacts with TRAF3 and promotes the activation of JNK(1).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.