Property Summary

NCBI Gene PubMed Count 21
PubMed Score 17.02
PubTator Score 13.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Astrocytoma, Pilocytic 1.300 3.4e-05
atypical teratoid / rhabdoid tumor -1.200 3.4e-04
glioblastoma 1.600 5.1e-03
medulloblastoma, large-cell -1.900 3.2e-05
osteosarcoma 2.253 4.4e-04
ovarian cancer 1.200 6.7e-04
pancreatic ductal adenocarcinoma liver m... -1.434 2.8e-03
Rheumatoid arthritis 1.600 2.2e-02
tuberculosis and treatment for 3 months -1.300 2.4e-03

Gene RIF (14)

AA Sequence

MVGKLKQNLLLACLVISSVTVFYLGQHAMECHHRIEERSQPVKLESTRTTVRTGLDLKANKTFAYHKDMP      1 - 70
LIFIGGVPRSGTTLMRAMLDAHPDIRCGEETRVIPRILALKQMWSRSSKEKIRLDEAGVTDEVLDSAMQA     71 - 140
FLLEIIVKHGEPAPYLCNKDPFALKSLTYLSRLFPNAKFLLMVRDGRASVHSMISRKVTIAGFDLNSYRD    141 - 210
CLTKWNRAIETMYNQCMEVGYKKCMLVHYEQLVLHPERWMRTLLKFLQIPWNHSVLHHEEMIGKAGGVSL    211 - 280
SKVERSTDQVIKPVNVGALSKWVGKIPPDVLQDMAVIAPMLAKLGYDPYANPPNYGKPDPKIIENTRRVY    281 - 350
KGEFQLPDFLKEKPQTEQVE                                                      351 - 370
//

Text Mined References (22)

PMID Year Title