Property Summary

NCBI Gene PubMed Count 20
PubMed Score 16.36
PubTator Score 13.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Rheumatoid Arthritis 1.600 2.2e-02
glioblastoma 1.600 5.1e-03
osteosarcoma 2.253 4.4e-04
atypical teratoid / rhabdoid tumor -1.200 3.4e-04
medulloblastoma, large-cell -1.900 3.2e-05
tuberculosis and treatment for 3 months -1.300 2.4e-03
pancreatic ductal adenocarcinoma liver m... -1.434 2.8e-03
pilocytic astrocytoma 1.300 4.6e-05
ovarian cancer 1.200 6.7e-04

Gene RIF (14)

PMID Text
26238632 TPST1 was significantly negatively correlated with the expression of cMet in lung cancer and may be a negative prognostic biomarker of lung cancer.
25079514 TPST1 rs3757417T>G polymorphisms are associated with colorectal cancer.
23472069 up-regulation of TPST-1 and tyrosine sulfation of CXCR4 by LMP1 might be a potential mechanism contributing to nasopharyngeal carcinoma metastasis
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
18672380 The kinetic parameters of tyrosylprotein sulfotransferase-1 and -2, catalyzing tyrosine sulfation of CCR8 peptides, were determined using liquid chromatography electrospray ionisation mass spectrometry.
16859706 Human tyrosylprotein sulfotransferase may be functional as homodimer/oligomer in the trans-Golgi compartment.
16244708 Affinity purified salivary TPST showed a single band of 50-54 kDa and is the first report characterizing a tyrosylprotein sulfotransferase in secretory fluid from the parotid gland
12169668 Tyrosine sulfation of CCR5 N-terminal peptide follows a discrete pattern and temporal sequence
12169668 The chemokine receptor CCR5 is posttranslationally modified by sulfation of its N-terminal tyrosines; sulfated tyrosines contribute to the binding of CCR5 to MIP-1 alpha, MIP-1 beta, and HIV-1 gp120/CD4 complexes and to the ability of HIV-1 to enter cells
12056800 Shear stress-dependent downregulation of TPST1 in human endothelium involves protein kinase C
12032733 results exclude TPST1 as the causative gene for Shwachman-Diamond syndrome
10497246 The chemokine receptor CCR5 is posttranslationally modified by sulfation of its N-terminal tyrosines; sulfated tyrosines contribute to the binding of CCR5 to MIP-1 alpha, MIP-1 beta, and HIV-1 gp120/CD4 complexes and to the ability of HIV-1 to enter cells
10089882 The chemokine receptor CCR5 is posttranslationally modified by sulfation of its N-terminal tyrosines; sulfated tyrosines contribute to the binding of CCR5 to MIP-1 alpha, MIP-1 beta, and HIV-1 gp120/CD4 complexes and to the ability of HIV-1 to enter cells

AA Sequence

MVGKLKQNLLLACLVISSVTVFYLGQHAMECHHRIEERSQPVKLESTRTTVRTGLDLKANKTFAYHKDMP      1 - 70
LIFIGGVPRSGTTLMRAMLDAHPDIRCGEETRVIPRILALKQMWSRSSKEKIRLDEAGVTDEVLDSAMQA     71 - 140
FLLEIIVKHGEPAPYLCNKDPFALKSLTYLSRLFPNAKFLLMVRDGRASVHSMISRKVTIAGFDLNSYRD    141 - 210
CLTKWNRAIETMYNQCMEVGYKKCMLVHYEQLVLHPERWMRTLLKFLQIPWNHSVLHHEEMIGKAGGVSL    211 - 280
SKVERSTDQVIKPVNVGALSKWVGKIPPDVLQDMAVIAPMLAKLGYDPYANPPNYGKPDPKIIENTRRVY    281 - 350
KGEFQLPDFLKEKPQTEQVE                                                      351 - 370
//

Text Mined References (20)

PMID Year Title
26238632 2015 Tyrosylprotein sulfotransferase 1 expression is negatively correlated with c?Met and lymph node metastasis in human lung cancer.
25079514 2015 Genetic variation in microRNA-binding site and prognosis of patients with colorectal cancer.
23472069 2013 Tyrosylprotein sulfotransferase-1 and tyrosine sulfation of chemokine receptor 4 are induced by Epstein-Barr virus encoded latent membrane protein 1 and associated with the metastatic potential of human nasopharyngeal carcinoma.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
18672380 2008 Mass spectrometric kinetic analysis of human tyrosylprotein sulfotransferase-1 and -2.
16859706 2006 Human TPST1 transmembrane domain triggers enzyme dimerisation and localisation to the Golgi compartment.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16244708 2005 Identification and characterization of tyrosylprotein sulfotransferase from human saliva.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12169668 2002 Tyrosine sulfation of CCR5 N-terminal peptide by tyrosylprotein sulfotransferases 1 and 2 follows a discrete pattern and temporal sequence.
12056800 2002 Shear stress mediates tyrosylprotein sulfotransferase isoform shift in human endothelial cells.
12032733 2002 Fine mapping of the locus for Shwachman-Diamond syndrome at 7q11, identification of shared disease haplotypes, and exclusion of TPST1 as a candidate gene.
9733778 1998 Molecular cloning and expression of human and mouse tyrosylprotein sulfotransferase-2 and a tyrosylprotein sulfotransferase homologue in Caenorhabditis elegans.
9501187 1998 Tyrosylprotein sulfotransferase: purification and molecular cloning of an enzyme that catalyzes tyrosine O-sulfation, a common posttranslational modification of eukaryotic proteins.
7721887 1995 Identification of three tyrosine residues of glycoprotein Ib alpha with distinct roles in von Willebrand factor and alpha-thrombin binding.