Property Summary

NCBI Gene PubMed Count 94
PubMed Score 155.21
PubTator Score 238.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Kidney cancer 2613 0.0 0.5

Expression

  Differential Expression (13)

Disease log2 FC p
acute quadriplegic myopathy 1.220 1.9e-05
astrocytic glioma 1.200 1.9e-02
Astrocytoma, Pilocytic 1.400 7.9e-06
atypical teratoid / rhabdoid tumor 1.200 1.1e-03
Down syndrome 2.100 2.0e-04
ependymoma 1.600 9.1e-03
glioblastoma 2.100 2.2e-02
group 3 medulloblastoma -1.300 8.6e-03
oligodendroglioma 2.200 6.7e-04
ovarian cancer -2.800 7.5e-13
pediatric high grade glioma 1.200 4.2e-03
Polycystic ovary syndrome -1.144 4.9e-02
tuberculosis 1.200 1.0e-06

Protein-protein Interaction (4)

Gene RIF (60)

AA Sequence

MGLQACLLGLFALILSGKCSYSPEPDQRRTLPPGWVSLGRADPEEELSLTFALRQQNVERLSELVQAVSD      1 - 70
PSSPQYGKYLTLENVADLVRPSPLTLHTVQKWLLAAGAQKCHSVITQDFLTCWLSIRQAELLLPGAEFHH     71 - 140
YVGGPTETHVVRSPHPYQLPQALAPHVDFVGGLHRFPPTSSLRQRPEPQVTGTVGLHLGVTPSVIRKRYN    141 - 210
LTSQDVGSGTSNNSQACAQFLEQYFHDSDLAQFMRLFGGNFAHQASVARVVGQQGRGRAGIEASLDVQYL    211 - 280
MSAGANISTWVYSSPGRHEGQEPFLQWLMLLSNESALPHVHTVSYGDDEDSLSSAYIQRVNTELMKAAAR    281 - 350
GLTLLFASGDSGAGCWSVSGRHQFRPTFPASSPYVTTVGGTSFQEPFLITNEIVDYISGGGFSNVFPRPS    351 - 420
YQEEAVTKFLSSSPHLPPSSYFNASGRAYPDVAALSDGYWVVSNRVPIPWVSGTSASTPVFGGILSLINE    421 - 490
HRILSGRPPLGFLNPRLYQQHGAGLFDVTRGCHESCLDEEVEGQGFCSGPGWDPVTGWGTPNFPALLKTL    491 - 560
LNP                                                                       561 - 563
//

Text Mined References (100)

PMID Year Title