Property Summary

NCBI Gene PubMed Count 250
PubMed Score 171.75
PubTator Score 911.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.400 2.6e-02
ependymoma -1.400 4.1e-02
oligodendroglioma -1.400 2.5e-02
psoriasis -2.800 4.6e-05
osteosarcoma -1.428 4.9e-05
atypical teratoid / rhabdoid tumor -1.800 1.8e-10
glioblastoma -1.400 4.1e-06
sonic hedgehog group medulloblastoma -1.200 8.0e-04
medulloblastoma, large-cell -1.700 3.5e-06
pancreatic ductal adenocarcinoma liver m... -1.581 2.1e-04
adult high grade glioma -1.400 2.6e-05

Protein-protein Interaction (1)

Gene RIF (250)

PMID Text
27333713 The most frequently occurring nonfunctional TPMT allele in Croatian population is TPMT*3A. Variant genotypes were statistically significantly more common in Crohn's disease subgroup than in ulcerative colitis subgroup.
26633017 Association of TPMT polymorphisms with overall azathioprine-induced adverse drug reactions, bone marrow toxicity and gastric intolerance, but not with hepatotoxicity (meta-analysis).
26411491 The TPMT promoter region may serve as a pharmacogenomic biomarker when introducing thiopurine therapy
26410243 structure-function relationships of TPMT
26072396 Identification of TPMT variants and subsequent dose reduction reduces hematologic events during thiopurine treatment of inflammatory bowel disease.
25940902 refinements in risk stratification and treatment have reduced the influence of TPMT genotype on treatment outcome in a contemporary protocol.
25819542 We report on the presence of the TPMT*3C and *3A mutant alleles in the Libyan population. Therefore, monitoring the patients to be treated with doses of thiopurine drugs for TPMT variants is worthwhile to avoid the development of severe myelosuppression.
25799415 association of TPMT polymorphisms with overall thiopurine-induced adverse drug reactions
25564374 Results show complete sequence-based screening study evaluating all TPMT variants in Asian populations some of them may ne of relevance in Korean population.
25551397 this paper shows that the influence of TPMT and COMT on the development of cisplatin-induced hearing loss may be less important than previously suggested.
25347948 Data suggest risk of myelotoxicity of high-dose methotrexate during methotrexate/6-mercaptopurine maintenance chemotherapy of childhood acute leukemia is not associated with heterozygosity in thiopurine methyltransferase in Nordic population studied.
24774509 TMPT genotyping appears an important tool to further optimize 6-MP treatment design in Chilean patients with ALL
24737678 suggest that germline genetic variation in TPMT and MTHFR do not significantly alter SOS risk in patients exposed to thioguanine
24710034 TPMT*37 introduces a premature stop codon at position 216, resulting in loss of the last 29 amino acid residues from the C terminal of the TPMT protein.
24696613 The prevalence of TPMT genotypes was high among Brazilian patients. Variants genes 2 and 3C may be associated with azathioprine pancreatic toxicity in a IBD southeastern Brazilian population
24643197 Activity measurement performed at diagnosis provides clinicians with information on immediate pharmacokinetic-related adverse events and/or hypermetabolism
24322830 TPMT*3c mutant allele was associated with azathioprine side effects (leukopenia, alopecia) in Chinese systemic lupus erythematosus patients.
24121523 Heart transplantation recipients with TPMT genetic variant alleles who are treated with AZA develop acute rejection earlier, more frequently, and of greater severity.
23996738 plays a key role in the metabolism of azathioprine/6- mercaptopurine (6-MP). Mutations in the enzyme lead to generation of excess thioguanine, which causes neutropenia via suppression of neutrophils.
23844534 A high frequency and diversity of variant TPMT genotypes was found in this series with predominance of the TPMT*3B allele
23820299 our results indicated that TPMT or COMT genetic variation was not related to cisplatin ototoxicity in children with cancer and did not influence cisplatin-induced hearing damage in laboratory models
23811272 differential contribution of the enzyme TPMT to the cytotoxicity of the two thiopurines is probably due to its role in formation of the meTIMP, the cytotoxic methylated metabolite of 6-MP
23731044 This study shows the prevalence of TPMT genetic polymorphisms in population of Slovak IBD patients
23588304 A predictive model combining variants in TPMT, ABCC3, and COMT with clinical variables significantly improved the prediction of hearing-loss development as compared with using clinical risk factors alone
23581716 distribution of the most frequent variants of TPMT gene was similar in a healthy population and patients with inflammatory bowel disease
23553048 TPMT*3A and the TPMT*3C, which cause the largest decrease in enzyme activity, were both variant alleles detected in the Tunisian population
23400745 In a study of Italian myasthenia gravis patients treated with azathioprine, a new TPMT haplotype, TPMT* 3E, was observed only in association with intolerance.
23398787 identify the most common genetic polymorphisms of TPMT in healthy Jordanian volunteers and patients with rheumatoid arthritis
23377985 this is the first study that assesses the TPMT variant allele frequencies in Guatemalan populations
23252716 In childhood acute lymphoblastic leukaemia, TPMT activity should not be used to predict heterozygosity particularly in blood samples obtained at disease diagnosis
23252704 Based on the HRMA and sequencing in the investigated group, two most frequent alleles for the Caucasian population were found: TPMT*1 with the frequency of 96.72% and TPMT*3A with the frequency of 3.28%.in this study of the polish population.
23192017 Letter/Case Report: TPMT monitoring is unable to predict azathiopurine-associated non-myelotoxicity.
23126166 SNP of TPMT (TPMT*3C) is recognized in only 1-2% of Japanese and its ill effect among them is difficult to surmise.
23065291 The G238C and A719G single nucleotide polymorphisms in the human TPMT gene are not associated with increased risk of developing acute lymphoblastic leukemia.
23025308 The study focused on explaining how a locally occurred TPMT A167G substitution propagated through hydrogen bonds alteration to induce structural modification which affects both thiopurine and S-adenosylmethionine receptors.
23014567 observed influence of the TMPT-genotype on MRD in patients with precursor B-ALL before application of mercaptopurines suggests a direct connection to the physiological role of TPMT
22972540 TPMT kd cells were more sensitive to 6-mercaptopurine (6-MP) (10 mumol/L) and 6-thioguanine (6-TG) (8 mumol/L) than wild-type (wt) cells, (32% versus 20%) and (18% versus 9%), respectively.
22931646 Severe intolerance to 6-mercaptopurine in children with acute lymphoblastic leukemia might be not related with the mutation of coding region in TPMT gene.
22846425 These data indicate that polymorphism in PACSIN2 significantly modulates TPMT activity and influences the risk of GI toxicity associated with mercaptopurine therapy.
22747506 TPMT*2 allelic variant displays a protected region in the C-terminus, which differs from wild-type TPMT, whereas the protected regions in TPMT*5 allele are located mainly in the N-terminus close to the active site.
22616585 aim of this study was to determine the frequency of the four most common allelic variants of TPMT gene in the population of Slovak IBD patients.TPMT genetic polymorphisms lead to dose-related hematopoetic toxicity
22594254 TPMT activity was measured in RBC by HPLC method.
22486532 High TPMT enzyme activity does not explain drug resistance Many of these patients preferentially produce the toxic 6-methylmercaptopurine metabolites (6-MMP) rather than the active 6-thioguanine nucleotides (6-TGN)
22385887 Inflammatory bowel disease patients may have significantly higher prevalence of TPMT polymorphism and, even more, low activity.
22318545 The distribution of TPMT, UGT1A1 and MDR1 gene polymorphisms of the South Indian population was significantly different from other populations.
22304581 6-mercaptopurine (6-MP) treatment results in a VNTR architecture-dependent decrease of TPMT gene transcription.
22225964 This study provides the first analysis of TPMT mutant allele frequency in individuals of Tunisian origin
21938428 Distributions of TPMT genotype and allele frequency in Iranian populations are different from the genetic profile found among Caucasian or Asian populations.
21819368 Frequency of thiopurine S-methyltransferase gene mutations is low among Iranian kidney transplant patients. The incidence of adverse reactions to azathioprine was also low.
21348397 Thioguanides family of drugs can cause life-threatening myelosuppression due to low activity of a critical metabolic enzyme, thiopurine S-methyl transferase
21254844 The distribution of NAT2, TPMT, and MTHFR gene polymorphisms in Baja California, Mexico exhibited allele and genotype frequencies that are highly similar to those observed in Caucasian populations.
20972624 A patient carrying TPMT*3C polymorphism is diagnosed with azathioprine-induced severe cholestatic hepatitis.
20945351 novel mutation, TPMT c.349>A,resulting in the amino acid substitution p.117G>R, caused misdiagnosis of TPMT deficiency
20881512 Characterization of a novel sequence variant, TPMT*28, in the human thiopurine methyltransferase gene
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20593505 Meta-analysis of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20521035 Observational study of genotype prevalence. (HuGE Navigator)
20408054 Observational study of genotype prevalence. (HuGE Navigator)
20403997 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20393862 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20350137 Both the number and type of VNTRs, as well as the upstream regulatory region of the TPMT gene promoter, determine the overall level of TPMT gene transcription.
20350137 Observational study of gene-disease association. (HuGE Navigator)
20349237 Case Report: invasive aspergillosis concomitant with azathioprine-induced leucopenia without carrying any TPMT mutant allele.
20308917 Data showed that it could be helpful to examine TPMT genotypes and to measure TPMT activity in Korean patients taking AZA/6-MP to predict the development of leukopenia.
20308917 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20175817 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20175804 approximately 1 in 180 persons born in Mexico City might have low or undetectable TPMT enzyme activity.
20175804 Observational study of genotype prevalence. (HuGE Navigator)
20173083 Observational study of genotype prevalence. (HuGE Navigator)
20153897 Thiopurine S-methyltransferase gene polymorphism is associated with less 6-mercaptopurine dose intensity in acute lymphoblastic leukemia.
20153897 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20136364 Observational study of genetic testing. (HuGE Navigator)
20136357 This meta-analysis suggests that individuals with both intermediate and absent TPMT activity have an increased risk of developing thiopurine-induced myelosuppression--REVIEW
20081263 Thiopurines administration is related to the increase in hemato-oncological treatment toxicity in TPMT heterozygotes.
20081263 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20066544 TPMT testing before starting a regimen of azathioprine in combination with N-acetylcysteine and steroids in idiopathic pulmonary fibrosis can predict likelihood of leukopenia.
20037211 Observational study of gene-disease association and genetic testing. (HuGE Navigator)
20027160 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20017316 Two novel heterozygote mutations, 210C>T (C70C, silent) and 622T>C (F208L), were identified in the coding region of the TPMT in Chinese children with acute leukemia.
20017316 Observational study of gene-disease association. (HuGE Navigator)
19956635 Uncategorized study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19898482 the strong associations of cisplatin-induced hearing loss with specific genetic variants in TPMT were identified
19891552 Observational study of gene-disease association. (HuGE Navigator)
19830600 TPMT polymorphisms are not associated with 6-mercaptopurine toxicity in precursor B acute lymphoblastic leukemia.
19830600 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19774638 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19748501 Data show that MTHFR and TYMS genotypes influence TPMT activity, and that males and females demonstrate differential modulation of TPMT activity.
19748501 Observational study of gene-disease association. (HuGE Navigator)
19695401 In these kidney transplant recipients, patients who carried the TPMT*3C allele were at a higher risk for azathioprine-induced myelosuppression than noncarriers
19695401 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19682195 Adverse reactions to azathioprine cannot be predicted by thiopurine S-methyltransferase genotype in Japanese patients with inflammatory bowel disease.
19682195 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19682085 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19675376 Observational study of genotype prevalence and genetic testing. (HuGE Navigator)
19650826 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19579612 Adverse reactions to thiopurines in IBD may be predisposed by thiopurine methyltransferase (TPMT) or inosine triphosphate pyrophosphatase (ITPA) gene mutation. Allele frequencies of TPMT*2, TPMT*3A, TPMT*3B, and TPMT*3C were 0, 0, 0, and 0.010 (17/1624).
19546880 Observational study of genotype prevalence. (HuGE Navigator)
19543639 The allele TPMT*3A, is the most prevalent in Chilean blood donors, as in Caucasian populations.
19543639 Observational study of genotype prevalence. (HuGE Navigator)
19535798 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19474452 Observational study of genetic testing. (HuGE Navigator)
19473575 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
19252404 We have demonstrated no significant association between TPMT variant alleles and adverse effects in Han Chinese IBD patients, so the prediction of AZA-related toxicity by TPMT genotyping remains imperfect.
19252404 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19239109 (Heterozygosity, PD, PIC, PE) of TPMT minisatellite locus showed that this marker is informative and can be used for DNA typing and population studies besides being used in clinical investigation in checking thiopurine drug sensitivity of individuals.
19239109 Observational study of genotype prevalence. (HuGE Navigator)
19229528 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19214663 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19177822 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19164342 Observational study of genetic testing. (HuGE Navigator)
19057372 The frequency of allele variants of gene TPMT*2, *3A, *3B, and *3C was estimated in a population of 116 Brazilian children with acute lymphoblastic leukemia.
19057372 Observational study of gene-disease association. (HuGE Navigator)
19048245 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19048244 Observational study of genotype prevalence. (HuGE Navigator)
19034904 found no significant association between TPMT SNPs and ALL treatment outcome; TPMT*3A is the most prevalent variant allele in the Russian Federation.
19034904 Observational study of gene-disease association. (HuGE Navigator)
18987660 Heterozygosity at the TPMT gene locus, augmented by mutated MTHFR gene, predisposes to 6-Mercaptopurine related toxicities in childhood ALL patients.
18987660 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18987654 Risk of relapse was higher for the 526 TPMT wild type patients than for the remaining 75 patients. Despite this, patients with low TPMT did not have superior survival possibly due to an excess of secondary cancers among these patients.
18987654 Observational study of gene-disease association. (HuGE Navigator)
18827410 TPMT mutations are not associated with myelosuppression in Japanese IBD patients. Even in IBD patients with a wild TPMT genotype, clinicians should pay attention for the possible development of myelosuppression.
18827410 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18823306 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18775689 Observational study of genotype prevalence and genetic testing. (HuGE Navigator)
18708949 analysis of thiopurine S-methyltransferase allelic variants
18693152 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18616518 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18605963 detected in an Estonoian population were 3 novel mutations -30T>A exon 3, 10A>G intron 3 & 145A>G intron 10; 4 markers whose frequencies were significantly different in intermediate methylators; 1 haplotype associated with intermediate TPMT activity
18602085 Identification and functional characterisation of four novel TPMT allelic variants.
18600549 the frequency of functional gene polymorphisms in 396 patients with inflammatory bowel disease and 300 healthy subjects
18600549 Observational study of gene-disease association. (HuGE Navigator)
18484748 Either Arg152 or Arg226 may participate in the TPMT reaction, with one residue compensating when the other is altered, and Arg152 may interact with substrate more directly than Arg226.
18482735 The A80P polymorphism in TPMT*2 disrupts helix alpha3 bordering the active site, which breaks several salt-bridge interactions and opens up a large cleft in the protein. The A154T polymorphism is located within the co-substrate binding site.
18467186 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18408566 Trinucleotide repeat variants in the promoter of the thiopurine S-methyltransferase gene of patients exhibiting ultra-high enzyme activity.
18408566 Observational study of gene-disease association. (HuGE Navigator)
18385010 Observational study of genetic testing. (HuGE Navigator)
18303966 A higher prevalence of TPMT deficiency was recorded than in previous studies. Afro-Caribbeans have lower activity than Caucasians and South Asians. TPMT enzyme activity was lower among females, especially in South Asians.
18193212 Observational study of gene-disease association. (HuGE Navigator)
18188716 Thiopurine S-methyltransferase gene (TMPT) polymorphisms in a Mexican population of healthy individuals and leukemic patients.
18021342 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17919375 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17909762 Observational study of genetic testing. (HuGE Navigator)
17885628 The novel variant allele of TPMT affects enzyme activity, as the individuals carrying it had almost undetectable TPMT activity.
17690215 Observational study of genetic testing. (HuGE Navigator)
17617792 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
17617792 study provides the first data on the frequency of common TPMT variants in the Turkish population, based on analysis of pediatric patients with acute lymphoblastic leukemia
17323057 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17243178 Structure of TPMT shows that naturally occurring amino acid polymorphisms scatter throughout, & amino acids whose alteration have most influence on function are those that form intra-molecular stabilizing interactions (mainly van der Waals contacts).
17241387 Observational study of genotype prevalence and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17241387 The relationship of TPMT genotype to azathioprine side effects is reported in Japanese patients with autoimmune liver diseases.
17220558 Observational study of gene-disease association. (HuGE Navigator)
17206640 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17176368 Observational study of gene-disease association. (HuGE Navigator)
17164697 Observational study of genotype prevalence, gene-disease association, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17152495 Observational study of gene-disease association. (HuGE Navigator)
17129980 Observational study of genotype prevalence. (HuGE Navigator)
17113562 Observational study of genotype prevalence. (HuGE Navigator)
17065060 TPMT does not appear to have a role in response to thiopurine treatment in inflammatory bowel disease
16952345 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16946561 Observational study of genotype prevalence. (HuGE Navigator)
16946561 Three novel single nucleotide polymorphisms (SNPs) of thiopurine S-methyltransferase were identified-106G>A in exon 3 (Gly36Ser, *20 allele), 967A>G in 3'-untranslated region, and -87C>T in intron 8.
16917910 Observational study of genotype prevalence. (HuGE Navigator)
16876902 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16789994 Observational study of genotype prevalence. (HuGE Navigator)
16773681 The only discovery translated until now into daily practice is the relation between thiopurine S-methyltransferase (TPMT) gene polymorphisms and hematological toxicity of thiopurine treatment in inflammatory bowel diseases (IBD).
16724002 Observational study of genotype prevalence and genetic testing. (HuGE Navigator)
16691038 Observational study of genotype prevalence, gene-disease association, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16643135 Observational study of genetic testing. (HuGE Navigator)
16611274 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16595084 Observational study of genotype prevalence. (HuGE Navigator)
16476125 Observational study of genotype prevalence. (HuGE Navigator)
16459728 Importance of performing surveillance testing for allelic characterization prior to treatment with azathioprine for multiple sclerosis.
16431304 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16418693 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16396707 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16306100 polymorphisma in the 5,10-methylenetetrahydrofolate reductase gene may play an important role in determing the erythrocyte thiopurine methyltransferase phenotype
16272700 Observational study of gene-disease association. (HuGE Navigator)
16214825 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16202677 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16166171 Observational study of genotype prevalence, gene-disease association, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16164497 Observational study of genotype prevalence. (HuGE Navigator)
16044099 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16044099 Genotyping for the major TPMT variant alleles may be valuable tool in preventing azathioprine toxicity.
16006997 Observational study of gene-disease association. (HuGE Navigator)
15973722 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15973722 TPMT, ITPA, and MTHFR genotypes do not predict adverse drug reactions, including bone marrow suppression, in liver transplant patients. Possible association between nodular regenerative hyperplasia and heterozygous TPMT genotype.
15967990 there is a unique pharmacogenetic mechanism by which common polymorphisms affect TPMT protein function and therapeutic response to thiopurine drugs
15946151 Genotyping for the major TPMT variant alleles may be valuable tool in preventing azathioprine toxicity.
15931768 Observational study of genotype prevalence. (HuGE Navigator)
15802809 Observational study of genetic testing. (HuGE Navigator)
15792824 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15784872 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15784872 TPMT genotype has a substantial impact on minimal residual disease after administration of mercaptopurine in the early course of childhood ALL, most likely through modulation of mercaptopurine dose intensity.
15709212 Specific genetic polymorphisms in drug metabolizing enzymes such as TPMT, drug transporters (MDR1), and drug target enzymes (TS) are associated with clinical outcomes in patients treated with chemotherapy drugs, such as 5-fluorouracil and irinotecan.
15691505 Observational study of genetic testing. (HuGE Navigator)
15571267 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15571267 TPMT promoter Variable Number Tandem Repeats are unlikely to play a significant role in changes in TPMT activity in response to azathioprine therapy
15571264 thiopurine methyltransferase polymorphisms modify the metabolism of the thiopurine drugs [review]
15476481 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15476481 TPMT genotype was an independent predictor for hemoglobin, hematocrit and red blood cell changes during azathioprine treatment after kidney transplantation.
15385838 Observational study of genotype prevalence. (HuGE Navigator)
15349717 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15349717 When azathioprine is administered at an initial dose of 1.5 mg/kg per day, both coding and promoter TPMT polymorphisms influence the dose tolerated.
15255798 Observational study of genotype prevalence. (HuGE Navigator)
15247157 Observational study of genetic testing. (HuGE Navigator)
15226673 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15226673 Provides solid basis to predict TPMT phenotype in a Northern European Caucasian population by molecular diagnostics.
15226671 Polymorphism affects pharmacogenetics. (review)
15206995 Observational study of genotype prevalence. (HuGE Navigator)
15022030 Observational study of gene-disease association. (HuGE Navigator)
14985891 Observational study of genotype prevalence. (HuGE Navigator)
14985891 Allelic variation at the TPMT (thiopurine S-methyltransferase) locus resulted in large inter-individual differences in the activity of enzyme TPMT, which the gene encodes and which are responsible for differences in toxicity/efficacy of thiopurine drugs.
14985890 Observational study of genetic testing. (HuGE Navigator)
14985890 Thiopurine S-methyltransferase (TPMT) polymorphisms have been linked with severe and potentially fatal myelosuppression in deficient metabolizers and rejection of transplanted organs in high metabolizers.
14723818 Observational study of gene-disease association. (HuGE Navigator)
14656901 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
14634700 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
14576848 REVIEW: pharmacogenetics of TPMT in cancer therapy
14508387 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
12972954 The pharmacogenetics of TPMT was studied in relation to drug toxicity and therapeutic efficacy.
12949626 Observational study of genotype prevalence. (HuGE Navigator)
12940924 Observational study of gene-disease association. (HuGE Navigator)
12903038 Allele frequency of TPMT*3C is low among Jing Chinese (1.0%), and TPMT*3C appears to be the most prevalent deleterious allele in this population.
12903038 Observational study of genotype prevalence. (HuGE Navigator)
12880540 Observational study of genotype prevalence. (HuGE Navigator)
12815366 Observational study of genotype prevalence. (HuGE Navigator)
12815366 This study is the first analysis of TPMT mutant allele frequency in a sample of the Brazilian population.
12814450 Observational study of genotype prevalence. (HuGE Navigator)
12777968 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
12777968 polymorphisms of thiopurine methyltransferase were studied in 306 healthy Brazilians who were classed, on the basis of self-declared colour and ancestry
12732844 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12703994 Observational study of genotype prevalence. (HuGE Navigator)
12563179 Observational study of gene-disease association. (HuGE Navigator)
12509611 Observational study of genotype prevalence, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12492733 Observational study of gene-disease association. (HuGE Navigator)
12217596 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12176518 Azathioprine toxicity is related to enzyme genotype (and mutation) in renal transplant patients.
12172211 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12142782 Observational study of genotype prevalence, gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12142782 Polymorphisms in TPMT are associated with acute lymphoblastic leukemia in Asians and whites
11927834 Observational study of genotype prevalence. (HuGE Navigator)
11927101 Defective methylation and subsequent hyperhomocysteinemia leading to impairment of thiopurine methyltransferase activity may serve as a MS susceptibility factor.
11503013 Observational study of genotype prevalence. (HuGE Navigator)
11422006 Observational study of genotype prevalence. (HuGE Navigator)
11025471 Observational study of genotype prevalence. (HuGE Navigator)
11007234 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
10751626 Observational study of genotype prevalence. (HuGE Navigator)

AA Sequence

MDGTRTSLDIEEYSDTEVQKNQVLTLEEWQDKWVNGKTAFHQEQGHQLLKKHLDTFLKGKSGLRVFFPLC      1 - 70
GKAVEMKWFADRGHSVVGVEISELGIQEFFTEQNLSYSEEPITEIPGTKVFKSSSGNISLYCCSIFDLPR     71 - 140
TNIGKFDMIWDRGALVAINPGDRKCYADTMFSLLGKKFQYLLCVLSYDPTKHPGPPFYVPHAEIERLFGK    141 - 210
ICNIRCLEKVDAFEERHKSWGIDCLFEKLYLLTEK                                       211 - 245
//

Text Mined References (258)

PMID Year Title
27333713 2016 AN EPIDEMIOLOGICAL STUDY OF THIOPURINE-METHYLTRANSFERASE VARIANTS IN A CROATIAN INFLAMMATORY BOWEL DISEASE PATIENT COHORT.
26633017 2015 Association between Thiopurine S-Methyltransferase Polymorphisms and Azathioprine-Induced Adverse Drug Reactions in Patients with Autoimmune Diseases: A Meta-Analysis.
26411491 2015 TPMT gene expression is increased during maintenance therapy in childhood acute lymphoblastic leukemia patients in a TPMT gene promoter variable number of tandem repeat-dependent manner.
26410243 2015 Structural and functional impact of missense mutations in TPMT: An integrated computational approach.
26072396 2015 Identification of Patients With Variants in TPMT and Dose Reduction Reduces Hematologic Events During Thiopurine Treatment of Inflammatory Bowel Disease.
25940902 2015 Thiopurine methyltransferase and treatment outcome in the UK acute lymphoblastic leukaemia trial ALL2003.
25819542 2015 Polymorphisms of the thiopurine S-methyltransferase gene among the Libyan population.
25799415 2015 Association between thiopurine S-methyltransferase polymorphisms and thiopurine-induced adverse drug reactions in patients with inflammatory bowel disease: a meta-analysis.
25564374 2015 Complete sequence-based screening of TPMT variants in the Korean population.
25551397 2014 Influence of genetic variants in TPMT and COMT associated with cisplatin induced hearing loss in patients with cancer: two new cohorts and a meta-analysis reveal significant heterogeneity between cohorts.
25347948 2015 Myelotoxicity after high-dose methotrexate in childhood acute leukemia is influenced by 6-mercaptopurine dosing but not by intermediate thiopurine methyltransferase activity.
25048487 2014 Monitoring thiopurine metabolites in korean pediatric patients with inflammatory bowel disease.
25036765 2014 Safe azathioprine treatment in a pediatric ulcerative colitis patient with TPMT*16 by thiopurine metabolite monitoring.
25000470 2015 Treatment-related myelodysplastic syndrome in a child with acute myeloid leukemia and TPMT heterozygosity.
24897283 2014 Interindividual variability in TPMT enzyme activity: 10 years of experience with thiopurine pharmacogenetics and therapeutic drug monitoring.
24860591 2014 Imputation of TPMT defective alleles for the identification of patients with high-risk phenotypes.
24774509 2014 Prevalence of TPMT and ITPA gene polymorphisms and effect on mercaptopurine dosage in Chilean children with acute lymphoblastic leukemia.
24737678 2014 TPMT and MTHFR genotype is not associated with altered risk of thioguanine-related sinusoidal obstruction syndrome in pediatric acute lymphoblastic leukemia: a report from the Children's Oncology Group.
24734162 2014 Assessment of Thiopurine-based drugs according to Thiopurine S-methyltransferase genotype in patients with Acute Lymphoblastic Leukemia.
24714787 2014 Misinterpretation of TPMT by a DTC genetic testing company.
24710034 2014 Identification of a novel thiopurine S-methyltransferase allele (TPMT*37).
24705376 2014 Enhanced specificity of TPMT*2 genotyping using unidirectional wild-type and mutant allele-specific scorpion primers in a single tube.
24696613 2014 Thiopurine-methyltransferase variants in inflammatory bowel disease: prevalence and toxicity in Brazilian patients.
24643197 2014 Augmenting clinical interpretability of thiopurine methyltransferase laboratory evaluation.
24390675 2014 Thiopurine S-methyltransferase (TPMT) activity is better determined by biochemical assay versus genotyping in the Jewish population.
24385893 2013 Phenome-wide association studies on a quantitative trait: application to TPMT enzyme activity and thiopurine therapy in pharmacogenomics.
24322830 2014 Association of thiopurine methyltransferase status with azathioprine side effects in Chinese patients with systemic lupus erythematosus.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24142665 2013 Successful azathioprine treatment with metabolite monitoring in a pediatric inflammatory bowel disease patient homozygous for TPMT*3C.
24121523 2013 TPMT genetic variants are associated with increased rejection with azathioprine use in heart transplantation.
24029750 2013 Aplastic anemia secondary to azathioprine in systemic lupus erythematosus: report of a case with normal thiopurine S-methyltransferase enzyme activity and review of the literature.
23996738 2014 Prevalence of TPMT polymorphism in Indian patients requiring immunomodulator therapy and its clinical significance.
23844534 [Analysis of genetic polymorphisms of thiopurine S-methyltransferase (TPMT) in Mexican pediatric patients with cancer].
23820299 2013 The role of inherited TPMT and COMT genetic variation in cisplatin-induced ototoxicity in children with cancer.
23811272 2013 Differential role of thiopurine methyltransferase in the cytotoxic effects of 6-mercaptopurine and 6-thioguanine on human leukemia cells.
23731044 2013 Prevalence of mutations in thiopurine S-methyltransferase gene among Slovak IBD patients.
23588304 2013 Replication of TPMT and ABCC3 genetic variants highly associated with cisplatin-induced hearing loss in children.
23581716 2013 Thiopurine S-Methyltransferase gene polymorphisms in a healthy Slovak population and pediatric patients with inflammatory bowel disease.
23553048 2013 Analysis of thiopurine S-methyltransferase phenotype-genotype in a Tunisian population with Crohn's disease.
23400745 2013 A new thiopurine s-methyltransferase haplotype associated with intolerance to azathioprine.
23398787 2013 Thiopurine S-methytransferase gene polymorphism in rheumatoid arthritis.
23377985 2013 Frequency of thiopurine S-methyltransferase mutant alleles in indigenous and admixed Guatemalan patients with acute lymphoblastic leukemia.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23252716 2013 Thiopurine methyltransferase genotype-phenotype discordance and thiopurine active metabolite formation in childhood acute lymphoblastic leukaemia.
23252704 2013 High-resolution melting analysis of the TPMT gene: a study in the Polish population.
23192017 Thiopurine methyltransferase measurement may not predict azathiopurine-associated non-myelotoxicity.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23126166 2012 [Genetic factors affecting elevated thiopurine sensitivity in Japanese patients with inflammatory bowel disease].
23065291 2013 Genetic polymorphisms of NQO1, CYP1A1 and TPMT and susceptibility to acute lymphoblastic leukemia in a Tunisian population.
23025308 2013 Insight into TPMT(?)23 mutation mis-folding using molecular dynamics simulation and protein structure analysis.
23014567 2013 Uncovering early, lineage-dependent effects of TPMT genotype in adult acute lymphoblastic leukemia by minimal residual disease.
22972540 2012 Establishment of thiopurine S-methyltransferase gene knockdown in jurkat T-lymphocytes: an in vitro model of TPMT polymorphism.
22931646 2012 [Thiopurine S-methyltransferase gene sequence analysis of ALL children severely intolerant to 6-mercaptopurine].
22846425 2012 PACSIN2 polymorphism influences TPMT activity and mercaptopurine-related gastrointestinal toxicity.
22747506 2012 Structural characteristics determine the cause of the low enzyme activity of two thiopurine S-methyltransferase allelic variants: a biophysical characterization of TPMT*2 and TPMT*5.
22616585 2012 Prevalence of mutations in thiopurine S-methyltransferase gene among Slovak IBD patients.
22594254 Thiopurine S-methyltransferase phenotype-genotype correlation in children with acute lymphoblastic leukemia.
22486532 2012 High TPMT enzyme activity does not explain drug resistance due to preferential 6-methylmercaptopurine production in patients on thiopurine treatment.
22385887 2012 High prevalence of polymorphism and low activity of thiopurine methyltransferase in patients with inflammatory bowel disease.
22318545 2012 Inter and intra-ethnic differences in the distribution of the molecular variants of TPMT, UGT1A1 and MDR1 genes in the South Indian population.
22304581 2012 6-mercaptopurine influences TPMT gene transcription in a TPMT gene promoter variable number of tandem repeats-dependent manner.
22225964 2012 Allele frequency of inosine triphosphate pyrophosphatase (ITPA) and thiopurine-S-methyl transferase (TPMT) genes in the Tunisian population.
21938428 2012 The frequency and distribution of thiopurine S-methyltransferase alleles in south Iranian population.
21819368 2011 Thiopurine S-methyltransferase polymorphism in Iranian kidney transplant recipients.
21520983 2011 Clinical relevance of thiopurine S-methyltransferase gene polymorphisms.
21348397 2010 Evaluating frequencies of thiopurine S-methyl transferase (TPMT) variant alleles in Israeli ethnic subpopulations using DNA analysis.
21269460 2011 Initial characterization of the human central proteome.
21254844 2011 Pharmacogenetic screening of N-acetyltransferase 2, thiopurine s-methyltransferase, and 5,10-methylene-tetrahydrofolate reductase polymorphisms in Northwestern Mexicans.
20972624 2010 Azathioprine-induced severe cholestatic hepatitis in patient carrying TPMT*3C polymorphism.
20945351 2011 Novel thiopurine methyltransferase variant TPMT*28 results in a misdiagnosis of TPMT deficiency.
20881512 2010 Characterization of a novel sequence variant, TPMT*28, in the human thiopurine methyltransferase gene.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20593505 2010 Thiopurine S-methyltransferase polymorphisms and thiopurine toxicity in treatment of inflammatory bowel disease.
20521035 2010 Genetic analysis of thiopurine methyltransferase polymorphism in the Jordanian population.
20408054 2010 Frequency of thiopurine S-methyltransferase (TPMT) alleles in southeast Iranian population.
20403997 2010 Genetic variation in 3-hydroxy-3-methylglutaryl CoA reductase modifies the chemopreventive activity of statins for colorectal cancer.
20393862 2010 The multidrug-resistance protein 4 polymorphism is a new factor accounting for thiopurine sensitivity in Japanese patients with inflammatory bowel disease.
20350137 2010 Functional analysis of the role of the TPMT gene promoter VNTR polymorphism in TPMT gene transcription.
20349237 2011 Invasive aspergillosis related with azathioprine-induced leucopenia without mutant allele of thioprine methyltransferase in a patient with rheumatoid arthritis.
20308917 Influences of thiopurine methyltransferase genotype and activity on thiopurine-induced leukopenia in Korean patients with inflammatory bowel disease: a retrospective cohort study.
20175817 2010 Thiopurine S-methyltransferase genotype and the use of thiopurines in paediatric inflammatory bowel disease Greek patients.
20175804 2009 Thiopurine S-methyltransferase (TPMT) genetic polymorphisms in Mexican newborns.
20173083 2010 Genetic variation in metabolizing enzyme and transporter genes: comprehensive assessment in 3 major East Asian subpopulations with comparison to Caucasians and Africans.
20153897 2010 Thiopurine S-methyltransferase gene polymorphism and 6-mercaptopurine dose intensity in Indian children with acute lymphoblastic leukemia.
20136364 2010 Errors and reproducibility of DNA array-based detection of allelic variants in ADME genes: PHARMAchip.
20136357 2010 Are patients with intermediate TPMT activity at increased risk of myelosuppression when taking thiopurine medications?
20081263 [Allelic variants of TPMT and the risk of leucopenia and neutropenia in patients treated for acute leukaemia].
20066544 2010 Thiopurine S- methyltransferase [corrected] testing in idiopathic pulmonary fibrosis: a pharmacogenetic cost-effectiveness analysis.
20037211 2009 TPMT and DPD polymorphisms: Efficient screening method for Indian patients considering taking Thiopurine and 5-FU drugs.
20017316 2009 [Studies on the mutation and polymorphism of the TPMT gene in Chinese children with acute leukemia].
19956635 2009 Fulfilling the promise of personalized medicine? Systematic review and field synopsis of pharmacogenetic studies.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19898482 2009 Genetic variants in TPMT and COMT are associated with hearing loss in children receiving cisplatin chemotherapy.
19891552 2009 Thiopurine S-methyltransferase pharmacogenetics in a large-scale healthy Italian-Caucasian population: differences in enzyme activity.
19830600 2010 Frequency of TPMT alleles in Indian patients with acute lymphatic leukemia and effect on the dose of 6-mercaptopurine.
19774638 2010 Pharmacogenomic variations in treatment protocols for childhood acute lymphoblastic leukemia.
19748501 2010 MTHFR and TYMS genotypes influence TPMT activity and its differential modulation in males and females.
19695401 2009 Impact of the heterozygous TPMT*1/*3C genotype on azathioprine-induced myelosuppression in kidney transplant recipients in Thailand.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19682195 2009 Adverse reactions to azathioprine cannot be predicted by thiopurine S-methyltransferase genotype in Japanese patients with inflammatory bowel disease.
19682085 2010 Association between inosine triphosphate pyrophosphohydrolase deficiency and azathioprine-related adverse drug reactions in the Chinese kidney transplant recipients.
19675376 2009 Application of SNaPshot for analysis of thiopurine methyltransferase gene polymorphism.
19650826 2009 Prospective study of the effects of concomitant medications on thiopurine metabolism in inflammatory bowel disease.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19579612 Allele frequency of thiopurine methyltransferase and inosine triphosphate pyrophosphatase gene polymorphisms in Korean patients with inflammatory bowel diseases.
19546880 2009 Influence of ethnicity on pharmacogenetic variation in the Ghanaian population.
19543639 2009 [Thiopurine S-methyltransferase gene polymorphism in Chilean blood donors].
19535798 2009 Thiopurine methyltransferase genetics is not a major risk factor for secondary malignant neoplasms after treatment of childhood acute lymphoblastic leukemia on Berlin-Frankfurt-Münster protocols.
19474452 2009 Perioperative genomic profiles using structure-specific oligonucleotide probes.
19473575 Genetic polymorphisms of thiopurine S-methyltransferase in a cohort of patients with systemic autoimmune diseases.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19252404 2009 Thiopurine methyltransferase gene polymorphisms in Chinese patients with inflammatory bowel disease.
19239109 2009 Characterization of TPMT minisatellite locus in five ethnic groups of India.
19229528 2009 TPMT but not ITPA gene polymorphism influences the risk of azathioprine intolerance in renal transplant recipients.
19214663 2009 Thiopurine S-methyltransferase and inosine triphosphate pyrophosphohydrolase genes in Japanese patients with inflammatory bowel disease in whom adverse drug reactions were induced by azathioprine/6-mercaptopurine treatment.
19177822 [Importance of genotyping of thiopurine S-methyltransferase in children with acute lymphoblastic leukaemia during maintenance therapy].
19164342 2009 Thiopurine S-methyltransferase genotype-phenotype concordance: used as a quality assurance tool to help control the phenotype assay.
19057372 2008 Thiopurine S-methyltransferase (TPMT) gene polymorphism in Brazilian children with acute lymphoblastic leukemia: association with clinical and laboratory data.
19048245 2009 Relationships between thiopurine S-methyltransferase polymorphism and azathioprine-related adverse drug reactions in Chinese renal transplant recipients.
19048244 2009 Distribution of TPMT risk alleles for thiopurine [correction of thioupurine] toxicity in the Israeli population.
19034904 2009 TPMT genetic variations in populations of the Russian Federation.
18987660 2009 Heterozygosity at the TPMT gene locus, augmented by mutated MTHFR gene, predisposes to 6-MP related toxicities in childhood ALL patients.
18987654 2009 Thiopurine methyltransferase activity is related to the risk of relapse of childhood acute lymphoblastic leukemia: results from the NOPHO ALL-92 study.
18827410 2008 Analysis of thiopurine S-methyltransferase genotypes in Japanese patients with inflammatory bowel disease.
18823306 2008 Population pharmacokinetic and pharmacogenetic analysis of 6-mercaptopurine in paediatric patients with acute lymphoblastic leukaemia.
18775689 2008 Duplex pyrosequencing of the TPMT*3C and TPMT*6 alleles in Korean and Vietnamese populations.
18708949 2008 Functional characterization of 23 allelic variants of thiopurine S-methyltransferase gene (TPMT*2 - *24).
18693152 Thiopurine S-methyltransferase genotypic analysis in autoimmune bullous diseases.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18616518 2008 Prospective evaluation of the pharmacogenetics of azathioprine in the treatment of inflammatory bowel disease.
18605963 2008 Thiopurine S-methyltransferase (TPMT) pharmacogenetics: three new mutations and haplotype analysis in the Estonian population.
18602085 2008 Characterisation of novel defective thiopurine S-methyltransferase allelic variants.
18600549 2008 Polymorphisms of the TPMT gene in the Czech healthy population and patients with inflammatory bowel disease.
18484748 2008 Structural basis of substrate recognition in thiopurine s-methyltransferase.
18482735 2008 Four human thiopurine s-methyltransferase alleles severely affect protein structure and dynamics.
18467186 2008 Thiopurine dose in intermediate and normal metabolizers of thiopurine methyltransferase may differ three-fold.
18408566 2008 Trinucleotide repeat variants in the promoter of the thiopurine S-methyltransferase gene of patients exhibiting ultra-high enzyme activity.
18385010 2008 TotalPlex gene amplification using bulging primers for pharmacogenetic analysis of acute lymphoblastic leukemia.
18318008 2008 Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.
18303966 2008 Ethnic variation of thiopurine S-methyltransferase activity: a large, prospective population study.
18193212 2008 Thiopurine S-methyltransferase activity in three major Asian populations: a population-based study in Singapore.
18188716 2008 Thiopurine S-methyltransferase gene (TMPT) polymorphisms in a Mexican population of healthy individuals and leukemic patients.
18021342 2007 Should TPMT genotype and activity be used to monitor 6-mercaptopurine treatment in children with acute lymphoblastic leukaemia?
17919375 2007 [Association between metabolic enzyme genotype of azathioprine and drug tolerance in patients with rheumatic diseases].
17909762 2007 Rapid genotyping of CYP2D6, CYP2C19 and TPMT polymorphisms by primer extension reaction in a dipstick format.
17885628 2007 Explaining TPMT genotype/phenotype discrepancy by haplotyping of TPMT*3A and identification of a novel sequence variant, TPMT*23.
17690215 2007 Microfluidic platform for single nucleotide polymorphism genotyping of the thiopurine S-methyltransferase gene to evaluate risk for adverse drug events.
17617792 2007 The low frequency of defective TPMT alleles in Turkish population: a study on pediatric patients with acute lymphoblastic leukemia.
17323057 2007 Genetic polymorphisms of folate metabolic enzymes and toxicities of high dose methotrexate in children with acute lymphoblastic leukemia.
17243178 2007 Structural basis of allele variation of human thiopurine-S-methyltransferase.
17241387 2007 Thiopurine S-methyltransferase gene polymorphism in Japanese patients with autoimmune liver diseases.
17220558 Thiopurine S-methyltransferase phenotype-genotype correlation in hemodialyzed patients.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17206640 2007 Glutathione-S-transferase genotypes and the adverse effects of azathioprine in young patients with inflammatory bowel disease.
17176368 2006 TPMT genotype and its clinical implication in renal transplant recipients with azathioprine treatment.
17164697 2006 Analysis of thiopurine S-methyltransferase polymorphism in the population of Serbia and Montenegro and mercaptopurine therapy tolerance in childhood acute lymphoblastic leukemia.
17152495 2006 [Relationships between thiopurine methyltransferase gene polymorphisms and its enzymatic activity].
17129980 2006 Genetic analyses of thiopurine methyltransferase polymorphisms in Greenlandic and Danish populations.
17113562 2007 Genotyping of eight polymorphic genes encoding drug-metabolizing enzymes and transporters using a customized oligonucleotide array.
17065060 2006 No induction of thiopurine methyltransferase during thiopurine treatment in inflammatory bowel disease.
16952345 2007 Efficient screening method of the thiopurine methyltransferase polymorphisms for patients considering taking thiopurine drugs in a Chinese Han population in Henan Province (central China).
16946561 2006 Three novel single nucleotide polymorphisms of the human thiopurine S-methyltransferase gene in Japanese individuals.
16917910 2006 Three novel thiopurine S-methyltransferase allelic variants (TPMT*20, *21, *22) - association with decreased enzyme function.
16876902 2006 Utility of thiopurine methyltransferase genotyping and phenotyping, and measurement of azathioprine metabolites in the management of patients with autoimmune hepatitis.
16789994 2006 Frequency of the thiopurine S-methyltransferase alleles in the ancient genetic population isolate of Sardinia.
16773681 2006 Pharmacogenetics in inflammatory bowel disease.
16724002 2006 Rapid genotyping of common deficient thiopurine S-methyltransferase alleles using the DNA-microchip technique.
16691038 2006 Thiopurine S-methyltransferase pharmacogenetics: genotype to phenotype correlation in the Slovenian population.
16643135 2006 Introducing a fast and simple PCR-RFLP analysis for the detection of mutant thiopurine S-methyltransferase alleles TPMT*3A and TPMT*3C.
16611274 2006 Pharmacogenetics of thiopurine therapy in paediatric IBD patients.
16595084 2006 [Frequency of thiopurine S-methyltransferase alleles in different ethnic groups living in Spain].
16476125 2006 Molecular analysis of thiopurine S-methyltransferase alleles in Taiwan aborigines and Taiwanese.
16459728 2006 Azathioprine myelosuppression in multiple sclerosis: characterizing thiopurine methyltransferase polymorphisms.
16431304 2006 Inosine triphosphate pyrophosphatase and thiopurine s-methyltransferase genotypes relationship to azathioprine-induced myelosuppression.
16418693 2006 Pharmacokinetics of 6-thioguanine in patients with inflammatory bowel disease.
16396707 Thiopurine S-methyltransferase polymorphisms and the relationship between the mutant alleles and the adverse effects in systemic lupus erythematosus patients taking azathioprine.
16306100 2005 Genetic variation in the MTHFR gene influences thiopurine methyltransferase activity.
16272700 2005 Thiopurine methyltransferase genotype and phenotype status in Japanese patients with systemic lupus erythematosus.
16220112 2005 Thiopurine S-methyltransferase pharmacogenetics: variant allele functional and comparative genomics.
16214825 2005 Association of inosine triphosphatase 94C>A and thiopurine S-methyltransferase deficiency with adverse events and study drop-outs under azathioprine therapy in a prospective Crohn disease study.
16202677 2005 TPMT genotype and the use of thiopurines in paediatric inflammatory bowel disease.
16166171 2005 Liquid chromatography-tandem mass spectrometry analysis of erythrocyte thiopurine nucleotides and effect of thiopurine methyltransferase gene variants on these metabolites in patients receiving azathioprine/6-mercaptopurine therapy.
16164497 2005 Molecular analysis of the thiopurine S-methyltransferase alleles in Bolivians and Tibetans.
16044099 2005 The impact of thiopurine s-methyltransferase polymorphism on azathioprine-induced myelotoxicity in renal transplant recipients.
16006997 2005 A comprehensive analysis of phase I and phase II metabolism gene polymorphisms and risk of colorectal cancer.
15973722 2005 Pharmacogenetic association with adverse drug reactions to azathioprine immunosuppressive therapy following liver transplantation.
15967990 2005 Human thiopurine S-methyltransferase pharmacogenetics: variant allozyme misfolding and aggresome formation.
15946151 2005 Azathioprine, 6-mercaptopurine and thiopurine S-methyltransferase.
15931768 2005 An interethnic comparison of polymorphisms of the genes encoding drug-metabolizing enzymes and drug transporters: experience in Singapore.
15819814 2005 Severe azathioprine-induced myelotoxicity in a kidney transplant patient with thiopurine S-methyltransferase-deficient genotype (TPMT*3A/*3C).
15802809 2005 Genotyping of thiopurine methyltransferase using pyrosequencing.
15792824 2005 Thiopurine methyltransferase (TPMT) heterozygosity and enzyme activity as predictive tests for the development of azathioprine-related adverse events.
15784872 2005 Thiopurine methyltransferase (TPMT) genotype and early treatment response to mercaptopurine in childhood acute lymphoblastic leukemia.
15709212 2005 Cancer pharmacogenomics: powerful tools in cancer chemotherapy and drug development.
15691505 2005 High-throughput detection of multiple genetic polymorphisms influencing drug metabolism with mismatch primers in allele-specific polymerase chain reaction.
15571267 2004 Genetic determinants of the pre- and post-azathioprine therapy thiopurine methyltransferase activity phenotype.
15571264 2004 The clinical impact of thiopurine methyltransferase polymorphisms on thiopurine treatment.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15476481 2004 Thiopurine S-methyltransferase genotype predicts azathioprine-induced myelotoxicity in kidney transplant recipients.
15385838 2004 Frequency distribution of thiopurine S-methyltransferase alleles in a polish population.
15349717 2004 The impact of thiopurine S-methyltransferase polymorphisms on azathioprine dose 1 year after renal transplantation.
15255798 2004 Phenotyping and genotyping study of thiopurine S-methyltransferase in healthy Chinese children: a comparison of Han and Yao ethnic groups.
15247157 2004 Rapid, long-range molecular haplotyping of thiopurine S-methyltransferase (TPMT) *3A, *3B, and *3C.
15226673 2004 Comprehensive analysis of thiopurine S-methyltransferase phenotype-genotype correlation in a large population of German-Caucasians and identification of novel TPMT variants.
15226671 2004 Closing the gap between science and clinical practice: the thiopurine S-methyltransferase polymorphism moves forward.
15206995 2004 Thiopurine S-methyltransferase genetic polymorphism in the Thai population.
15167635 2004 Frequency distribution of thiopurine S-methyltransferase activity in red blood cells of a healthy Japanese population.
15022030 2004 Phenotype and genotype for thiopurine methyltransferase activity in the French Caucasian population: impact of age.
14987117 2004 Clinical utility of thiopurine S-methyltransferase genotyping.
14985891 2004 Gene mutation of thiopurine S-methyltransferase in Uygur Chinese.
14985890 2004 Thiopurine S-methyltransferase polymorphisms: efficient screening method for patients considering taking thiopurine drugs.
14723818 2003 [Relationship between single nucleotide polymorphisms in thiopurine methyltransferase gene and tolerance to thiopurines in acute leukemia].
14656901 2004 Pyrosequencing of TPMT alleles in a general Swedish population and in patients with inflammatory bowel disease.
14634700 2004 Thiopurine methyltransferase (TPMT) genotype distribution in azathioprine-tolerant and -intolerant patients with various disorders. The impact of TPMT genotyping in predicting toxicity.
14576848 2003 Drug methylation in cancer therapy: lessons from the TPMT polymorphism.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
14508387 2003 Phenotypic and genotypic analysis of thiopurine s-methyltransferase polymorphism in the bulgarian population.
12972954 2003 Thiopurine S-methyltransferase pharmacogenetics: chaperone protein association and allozyme degradation.
12949626 Allelic variants of the thiopurine methyltransferase (TPMT) gene in the Colombian population.
12940924 2003 Thiopurine S-methyltransferase (TPMT) genotype does not predict adverse drug reactions to thiopurine drugs in patients with inflammatory bowel disease.
12903038 2003 [Mutant thiopurine S-methyltransferase alleles among Jing Chinese in Guangxi province].
12880540 2003 Genetic polymorphism of thiopurine S-methyltransferase in Argentina.
12815366 2003 Thiopurine methyltransferase polymorphisms in a Brazilian population.
12814450 2003 Genotype and allele frequencies of TPMT, NAT2, GST, SULT1A1 and MDR-1 in the Egyptian population.
12777968 2003 Thiopurine methyltransferase phenotypes and genotypes in Brazilians.
12732844 2003 A study to survey susceptible genetic factors responsible for troglitazone-associated hepatotoxicity in Japanese patients with type 2 diabetes mellitus.
12703994 2003 [Genetic polymorphism of the thiopurine S-methyltransferase of healthy Han Chinese].
12563179 2003 Genetic determinants of the thiopurine methyltransferase intermediate activity phenotype in British Asians and Caucasians.
12542916 2003 Measurement of thiopurine S-methyltransferase activity in human blood samples based on high-performance liquid chromatography: reference values in erythrocytes from children.
12509611 2003 Is thiopurine methyltransferase genetic polymorphism a major factor for withdrawal of azathioprine in rheumatoid arthritis patients?
12492733 2003 Thiopurine methyltransferase genotype distribution in patients with Crohn's disease.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12217596 2002 Thiopurine methyltransferase phenotype and genotype in relation to azathioprine therapy in autoimmune hepatitis.
12176518 2002 Azathioprine toxicity and thiopurine methyltransferase genotype in renal transplant patients.
12172211 2002 Azathioprine therapy and adverse drug reactions in patients with inflammatory bowel disease: impact of thiopurine S-methyltransferase polymorphism.
11927834 2002 Molecular analysis of thiopurine S-methyltransferase alleles in South-east Asian populations.
11927101 2002 [Hypomethylation and multiple sclerosis, the susceptibility factor?].
11503013 2001 Detection of one single mutation predicts thiopurine S-methyltransferase activity in a population of Saami in northern Norway.
11422006 2001 Frequencies of thiopurine S-methyltransferase mutant alleles (TPMT*2, *3A, *3B and *3C) in 151 healthy Japanese subjects and the inheritance of TPMT*3C in the family of a propositus.
11025471 2000 Frequency of thiopurine S-methyltransferase genetic variation in Thai children with acute leukemia.
11007234 2000 Allelic variants of the thiopurine S-methyltransferase deficiency in patients with ulcerative colitis and in healthy controls.
10751626 2000 Genetic analysis of thiopurine methyltransferase polymorphism in a Japanese population.
10208641 1999 The frequency and distribution of thiopurine methyltransferase alleles in Caucasian and Asian populations.
9931346 1999 Polymorphism of the thiopurine S-methyltransferase gene in African-Americans.
9931345 1999 Thiopurine methyltransferase alleles in British and Ghanaian populations.
9711875 1998 Detection of known and new mutations in the thiopurine S-methyltransferase gene by single-strand conformation polymorphism analysis.
9453052 1997 Promoter and intronic sequences of the human thiopurine S-methyltransferase (TPMT) gene isolated from a human PAC1 genomic library.
9336428 1997 Azathioprine-induced severe pancytopenia due to a homozygous two-point mutation of the thiopurine methyltransferase gene in a patient with juvenile HLA-B27-associated spondylarthritis.
9246020 1997 Human thiopurine methyltransferase pharmacogenetics: gene sequence polymorphisms.
9177237 1997 Enhanced proteolysis of thiopurine S-methyltransferase (TPMT) encoded by mutant alleles in humans (TPMT*3A, TPMT*2): mechanisms for the genetic polymorphism of TPMT activity.
9103127 1997 Molecular diagnosis of thiopurine S-methyltransferase deficiency: genetic basis for azathioprine and mercaptopurine intolerance.
8873214 1996 Genetic polymorphism of thiopurine S-methyltransferase: clinical importance and molecular mechanisms.
8644731 1996 Thiopurine S-methyltransferase deficiency: two nucleotide transitions define the most prevalent mutant allele associated with loss of catalytic activity in Caucasians.
8561894 1996 Thiopurine methyltransferase pharmacogenetics: human gene cloning and characterization of a common polymorphism.
8392551 1993 Diethyldithiocarbamate S-methylation: evidence for catalysis by human liver thiol methyltransferase and thiopurine methyltransferase.
8316220 1993 Human thiopurine methyltransferase: molecular cloning and expression of T84 colon carcinoma cell cDNA.
7862671 1995 A single point mutation leading to loss of catalytic activity in human thiopurine S-methyltransferase.
7628307 1995 Thiopurine methyltransferase pharmacogenetics. Cloning of human liver cDNA and a processed pseudogene on human chromosome 18q21.1.