Property Summary

NCBI Gene PubMed Count 136
PubMed Score 139.72
PubTator Score 43.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Hemolytic anemia 70 0.0 2.0
Orofacial cleft 38 0.0 1.0
Disease Target Count Z-score Confidence
Hypertrophic Cardiomyopathy 56 5.955 3.0
Dilated cardiomyopathy 51 4.267 2.1
Disease Target Count Z-score Confidence
Cardiomyopathy 110 0.0 4.0

Expression

  Differential Expression (22)

Disease log2 FC p
gastric cancer 1.600 2.1e-03
pancreatic cancer 2.000 9.2e-04
malignant mesothelioma -1.500 2.5e-06
psoriasis -2.300 1.0e-03
cystic fibrosis -1.222 6.7e-05
glioblastoma 1.300 2.3e-02
atypical teratoid/rhabdoid tumor 1.700 1.3e-04
group 4 medulloblastoma -2.100 1.7e-05
medulloblastoma, large-cell -1.500 9.9e-05
Duchenne muscular dystrophy 1.190 9.5e-05
autosomal dominant Emery-Dreifuss muscul... 1.067 3.1e-02
acute quadriplegic myopathy -1.033 1.4e-03
Atopic dermatitis -1.300 1.2e-03
pancreatic ductal adenocarcinoma liver m... 2.456 1.7e-02
intraductal papillary-mucinous adenoma (... -1.400 1.6e-02
colon cancer -2.500 1.0e-03
fibroadenoma 1.100 5.0e-02
pancreatic carcinoma 2.000 9.2e-04
acute myeloid leukemia -1.200 3.5e-02
inflammatory breast cancer -1.400 8.3e-03
ovarian cancer -3.400 2.5e-12
dermatomyositis 2.200 1.3e-02

 GWAS Trait (1)

Gene RIF (84)

PMID Text
26873245 The mutation reduced binding affinity for both Lmod2 and Tmod1. The effect of the K15N mutation on Tpm1.1 binding to Lmod2 and Tmod1 provides a molecular rationale for the development of familial dilated cardiomyopathies .
26400351 The TPM1 (rs1071646) and TNNT2 (rs3729547) gene variants might represent risk factors for patients with dilated cardiomyopathy in the Kazakh population.
26200873 Data confirm that the substitutions of the Tpm1 residues G126 and D137 with the canonical ones, Arg and Leu, respectively, increase the stiffness of the Tpm coiled-coil
25873252 these results indicate that TPM1 may be one mechanism underlying radiation resistance, and TPM1 may be a potential target for overcoming the radiation resistance in glioma.
25607779 Coexistence of Digenic Mutations in Both TPM1 and MYH7 Genes Leads to Severe Hypertrophic Cardiomyopathy.
25607530 TPM1 exhibits characteristics of a tumor-suppressor gene while being overexpressed in Renal cell carcinoma cell lines.
25548289 Mutant TPM1cause m ultiple functional alterations in actin affinity and Ca2+ sensitivity.
25408381 Mitochondrial RNA induces tropomyosin synthesis.
25241052 cardiomyopathy-associated E62Q tropomyosin mutation weakens actin-tropomyosin interaction, but phosphorylation of neighboring S61 rescues the binding-deficit, results confirmed experimentally by in vitro motility assays.
24958154 We have quantified the expression of the total sarcomeric TPM1 and observed a 1.5-fold increase in treated cells.
24585742 Development of pathological hypertrophy did not occur in mice expressing both Tm180 and TnI-PP.
24112450 Vardenafil administration improved erectile functionality in controlled type 2 diabetes mellitus patients with ED, which was associated with reduction of circulating plasma beta-tropomyosin levels.
24005378 effects of the mutations in the TPM1 gene on hypertrophic cardiomyopathy and dilated cardiomyopathy development (Review)
23792823 In addition to CLIC1 and TPM1, which were the proteins initially discovered in a xenograft mouse model, CLIC4, TPM2, TPM3, and TPM4 were present in ovarian cancer patient sera at significantly elevated levels compared with controls.
23782526 Somatic mutations in MYH7, MYBPC3, TPM1, TNNT2, and TNNI3 do not represent an important etiologic pathway in HCM.
23420843 analysis of the pattern of of evolutionarily conserved basic and acidic residues that constitutes the binding interface of actin-tropomyosin
23254774 These data indicated that TPM1 is downregulated in HuCCT1 cells and that the Ras signaling pathway as well as DNA methylation, histone deacetylation and miR-21 upregulation play important roles in the suppression of TPM1 expression in HuCCT1 cells.
23205574 Elevated TPM1 and TPM2 expression is associated with epithelial-mesenchymal transition of lens epithelial cells.
23147248 A novel TPM-1 mutation associates with dilated and non-compaction cardiomyopathy and diminishes actin binding.
22965424 Downregulation of tropomyosin-1 in squamous cell carcinoma of esophagus.
22958892 Familial hypertrophic cardiomyopathy mutation E180G enhances Ca(2+)-sensitivity in functional assays. Increased flexibility of the mutant was confirmed by fitting end-to-end length distributions to the worm-like chain model.
22789852 this study compared the bending flexibility of wild-type tropomyosin to that of two mutant tropomyosins, Asp175Asn and Glu180Gly, known to be associated with hypertrophic cardiomyopathy.
22740512 Expression of low molecular weight isoforms from TPM1 and TPM3 genes is regulated very differently, which has a critical role in processes such as cancer metastasis.
22737252 Persistence length of human cardiac alpha-tropomyosin measured by single molecule direct probe microscopy
22462493 TPM1-D175N and myosin-binding protein-Q1061X mutations account for a substantial part of all hypertrophic cardiomyopathy (HCM) cases in the Finnish population. Routine genetic screening of these mutations is warranted in Finnish patients with HCM.
22447464 variable myocardial and systemic inflammatory response was demonstrated in patients with HCM attributable to an identified sarcometric mutation.
22187526 Functional and structural differences in three familial hypertrophic cardiomyopathy-related mutations in recombinant alpha-Tm were characterized using both conventional and modified in vitro motility assays and circular dichroism spectroscopy.
22155441 This work studied how the hypertrophic cardiomyopathy-causing Asp175Asn and Glu180Gly mutations in alpha-tropomyosin affect on actin-myosin interaction during the ATPase cycle
21949785 IgE recognition profile of profilins, PR-10 proteins and tropomyosin, were evaluated.
21823217 This is the first report of mutations in TPM1, MY L3, and MYL2 associated with primary, non-hypertrophied restrictive cardiomyopathy.
21817107 The hypoxia inducible factor-1 alpha/miR-21/tropomyosin 1 pathway may play a critical role in the pathogenesis of arteriosclerosis obliterans.
21741356 effect of Glu40Lys mutant alpha-tropomyosin on the mobility and rotation of subdomain-1 of actin and the SH1 helix of myosin subfragment-1 during the ATP hydrolysis cycle has been demonstrated
21551322 identified 5 mutations in cardiac myosin-binding protein C (MYBPC3) and 2 mutations in alpha-tropomyosin (TPM1) in a cohort of unrelated adult probands with isolated left ventricular noncompaction cardiomyopathy
21454502 Conserved noncanonical residue Gly-126 confers instability to the middle part of the tropomyosin molecule.
21376702 Asp175Asn and Glu180Gly mutations were found to shift tropomyosin strands further towards the open position and to change the affinity of tropomyosin for actin.
21320446 The increased number of actively cycling cross bridges is the major cause of Tm mutation-related hypertrophic cardiomyopathy pathogenesis.
21295541 results suggest that the E180G and D175N mutations reduce the affinity of tropomyosin for actin and also destabilize troponin binding to the actin thin filaments
21274714 Patients with HCM attributable to D175N mutation of alpha-tropomyosin were studied by CMRI. LV maximal thickness by CMRI is the best parameter in differentiating between LVH due to mild-to-moderate hypertension and HCM attributable to a sarcomeric mutation.
20965760 TPM1 is a potential candidate disease-causing gene for isolated LVNC, especially in patients experiencing sudden death.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20474083 Observational study of genetic testing. (HuGE Navigator)
20381070 This protein has been found differentially expressed in the anterior cingulate cortex from patients with schizophrenia
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20359594 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20215591 Six different novel protein-altering variants of tropomyosin 1 were identified among 6 probands, and all of the nucleotide changes were considered possibly or likely disease causing.
20215591 Observational study of gene-disease association. (HuGE Navigator)
20075843 A polymorphism in the TPM1 short isoform promoter region is predicted to alter transcription factor binding, alters gene expression and is associated with the metabolic syndrome.
20075843 Observational study of gene-disease association. (HuGE Navigator)
20065163 functional analysis of TPM1kappa provides a possible mechanism for the consequences of the TM isoform switch observed in dilated cardiomyopathy and heart failure patients
20031618 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19875404 Observational study of gene-disease association. (HuGE Navigator)
19853701 Observational study of gene-disease association. (HuGE Navigator)
19678923 KRAS mutations correlate with expression of DCN and TPM1 in colorectal cancer.
19646950 data demonstrate specific changes caused by the dilated cardiomyopathy Glu54Lys mutation on the mutually dependent and concerted conformational changes in actin & myosin during the ATPase cycle, which are likely to underlie the observed functional effects
19509158 miR-21 is an independent prognostic indicator for tongue squamous cell carcinomas (TSCC), and may play a role in TSCC development by inhibiting cancer cell apoptosis partly via TPM1 silencing.
19293840 Observational study of gene-disease association. (HuGE Navigator)
19222994 Dilated cardiomyopathy Glu40Lys and Glu54Lys mutations in alpha-tropomyosin induce a shifting of tropomyosin strands to the periphery of thin filament towards the "blocked" position and change the affinity of tropomyosin binding to actin.
19150014 Observational study of gene-disease association. (HuGE Navigator)
19035361 TPM1 mutation was found involved in hypertrophic cardiomyopathy.
18937355 tropomyosin 1 and cofilin play antagonistic roles within the contractile ring and that the balance between tropomyosin 1 and cofilin expression is important for cytokinesis.
18513529 Observational study of gene-disease association. (HuGE Navigator)
18403758 Observational study of gene-disease association. (HuGE Navigator)
17932326 data illustrate that, in general, dilated cardiomyopathy and hypertrophic cardiomyopathy mutations in troponin and alpha-tropomyosin have opposite effects on the Ca2+ affinity of reconstituted thin filaments
17895359 study reports that DAP kinase promotes in vitro & in vivo phosphorylation of tropomyosin-1 on Ser283 & that this phosphorylation is essential for the H2O2-induced organization of the assembly of actin stress fibers in endothelial cells
17556170 in hypertrophic cardiomyopathy attributable to the Asp175Asn mutation in the alpha-tropomyosin gene, myocardial oxidative metabolism and FFA metabolism are increased and inversely related to LV hypertrophy at both the whole heart and regional level
17360712 the familial dilated cardiomyopathy-causing mechanism of the E40K mutation may be accounted for by destabilization of the On state of the cardiac muscle thin filaments; the E54K mutation has a more complex effect on tropomyosin structure & function
16260624 alternative splicing of alpha-TM may be regulated by the antagonistic splicing regulators RBM4 and PTB
15897890 Epigenetic suppression of TPM1 may alter TGF-beta tumor suppressor function and contribute to metastatic properties of tumor cells.
15695827 the role of tropomyosin is to facilitate the transmission of structural changes along the F-actin filament so that the monomers within a structural unit are able to interact with myosin
15479242 Effect of three point mutations is related to the overall stability of Tm as a whole, and that the mutations have only minor effects on the cooperative interactions among proteins that constitute the thin filament.
15269838 HPRG binds to endothelial cell surface tropomyosin which at least partially mediates the antiangiogenic effects of HPRG
15031138 proposed a hypothesis of pathogenetic changes caused by alpha-tropomyosin mutation Asp(175)Asn in familial hypertrophic cardiomyopathy on basis of changes in Ca(2+) handling as sensitive mechanism to compensate for alterations in sarcomeric structure.
15000344 A previously described alpha-tropomyosin (TPM1) mutation (Asp175Asn) was found in 11% of cases.
13679858 Loss of expression of TPM1 induces anoikis in primary breast tumors.
12686598 tropomyosin-1 is phosphorylated downstream of ERK, an event that modulates its interaction with actin
12527301 identified and demonstrated that the intracellular C terminus of polycystin-2 associates with a core regulatory protein of the actin cytoskeleton system, tropomyosin-1
12473556 Observational study of gene-disease association. (HuGE Navigator)
12169652 the expression of the human Hypertrophic Cardiomyopathy Mutant Tropomyosin in transgenic Mice results in myocardial contractile dysfunction
12065096 These data, for the first time, show that hypermethylation of TM1 gene and chromatin remodeling are the predominant mechanisms by which TM1 expression is downregulated in breast cancer cells.
11964245 requires an intact N-terminal coiled coil to interact with tropomodulin
8424456 Exposure of human skin fibroblasts to HIV-1 protease induces the degradation of the vimentin filament network and the disappearance of the tropomyosin isoforms microfilament network
1991513 Exposure of human skin fibroblasts to HIV-1 protease induces the degradation of the vimentin filament network and the disappearance of the tropomyosin isoforms microfilament network
1516138 Exposure of human skin fibroblasts to HIV-1 protease induces the degradation of the vimentin filament network and the disappearance of the tropomyosin isoforms microfilament network

AA Sequence

MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEK      1 - 70
LELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEK     71 - 140
MEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQ    141 - 210
AEKYSQKEDRYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALND    211 - 280
MTSI                                                                      281 - 284
//

Text Mined References (142)

PMID Year Title
26873245 2016 Localization of the binding interface between leiomodin-2 and ?-tropomyosin.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26400351 2015 Significance of sarcomere gene mutation in patients with dilated cardiomyopathy.
26200873 2015 Stabilizing the central part of tropomyosin increases the bending stiffness of the thin filament.
25873252 2015 Silencing of the TPM1 gene induces radioresistance of glioma U251 cells.
25607779 2015 Coexistence of Digenic Mutations in Both Thin (TPM1) and Thick (MYH7) Filaments of Sarcomeric Genes Leads to Severe Hypertrophic Cardiomyopathy in a South Indian FHCM.
25607530 2015 Clinical and tumor significance of tropomyosin-1 expression levels in renal cell carcinoma.
25548289 2015 Mechanistic heterogeneity in contractile properties of ?-tropomyosin (TPM1) mutants associated with inherited cardiomyopathies.
25416956 2014 A proteome-scale map of the human interactome network.
25408381 2015 Identification of a human mitochondrial RNA that promotes tropomyosin synthesis and myocardial differentiation.
25369766 2015 A systematic nomenclature for mammalian tropomyosin isoforms.
25241052 2014 Energy landscapes reveal the myopathic effects of tropomyosin mutations.
24958154 2015 Expression of sarcomeric tropomyosin in striated muscles in axolotl treated with shz-1, a small cardiogenic molecule.
24585742 2014 Desensitization of myofilaments to Ca2+ as a therapeutic target for hypertrophic cardiomyopathy with mutations in thin filament proteins.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24112450 2013 Vardenafil improves penile erection in type 2 diabetes mellitus patients with erectile dysfunction: role of tropomyosin.
24005378 2013 Alpha-tropomyosin mutations in inherited cardiomyopathies.
23792823 2013 Protein isoform-specific validation defines multiple chloride intracellular channel and tropomyosin isoforms as serological biomarkers of ovarian cancer.
23782526 2013 Somatic MYH7, MYBPC3, TPM1, TNNT2 and TNNI3 mutations in sporadic hypertrophic cardiomyopathy.
23420843 2013 A periodic pattern of evolutionarily conserved basic and acidic residues constitutes the binding interface of actin-tropomyosin.
23254774 2013 Genetic and epigenetic alterations are involved in the regulation of TPM1 in cholangiocarcinoma.
23205574 2013 Elevated tropomyosin expression is associated with epithelial-mesenchymal transition of lens epithelial cells.
23147248 2013 A novel alpha-tropomyosin mutation associates with dilated and non-compaction cardiomyopathy and diminishes actin binding.
22965424 2012 Downregulation of tropomyosin-1 in squamous cell carcinoma of esophagus, the role of Ras signaling and methylation.
22958892 2012 Familial hypertrophic cardiomyopathy related E180G mutation increases flexibility of human cardiac ?-tropomyosin.
22863734 2012 Genome-wide meta-analyses of nonsyndromic cleft lip with or without cleft palate identify six new risk loci.
22789852 2012 The flexibility of two tropomyosin mutants, D175N and E180G, that cause hypertrophic cardiomyopathy.
22740512 2012 Functional structure of the promoter regions for the predominant low molecular weight isoforms of tropomyosin in human kidney cells.
22737252 2012 Persistence length of human cardiac ?-tropomyosin measured by single molecule direct probe microscopy.
22462493 2013 Two founder mutations in the alpha-tropomyosin and the cardiac myosin-binding protein C genes are common causes of hypertrophic cardiomyopathy in the Finnish population.
22447464 2012 Low-grade inflammation and the phenotypic expression of myocardial fibrosis in hypertrophic cardiomyopathy.
22187526 2011 Facilitated cross-bridge interactions with thin filaments by familial hypertrophic cardiomyopathy mutations in ?-tropomyosin.
22155441 2012 The effect of the Asp175Asn and Glu180Gly TPM1 mutations on actin-myosin interaction during the ATPase cycle.
22139419 2011 New gene functions in megakaryopoiesis and platelet formation.
21949785 2011 IgE recognition patterns of profilin, PR-10, and tropomyosin panallergens tested in 3,113 allergic patients by allergen microarray-based technology.
21823217 2011 Furthering the link between the sarcomere and primary cardiomyopathies: restrictive cardiomyopathy associated with multiple mutations in genes previously associated with hypertrophic or dilated cardiomyopathy.
21817107 2011 MicroRNA-21 regulates vascular smooth muscle cell function via targeting tropomyosin 1 in arteriosclerosis obliterans of lower extremities.
21741356 2011 The effect of the dilated cardiomyopathy-causing Glu40Lys TPM1 mutation on actin-myosin interactions during the ATPase cycle.
21551322 2011 Sarcomere gene mutations in isolated left ventricular noncompaction cardiomyopathy do not predict clinical phenotype.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21454502 2011 Conserved noncanonical residue Gly-126 confers instability to the middle part of the tropomyosin molecule.
21376702 2011 Hypertrophic cardiomyopathy-causing Asp175asn and Glu180gly Tpm1 mutations shift tropomyosin strands further towards the open position during the ATPase cycle.
21320446 2011 Enhanced active cross-bridges during diastole: molecular pathogenesis of tropomyosin's HCM mutations.
21295541 2011 Several cardiomyopathy causing mutations on tropomyosin either destabilize the active state of actomyosin or alter the binding properties of tropomyosin.
21274714 2011 Cardiac MRI assessed left ventricular hypertrophy in differentiating hypertensive heart disease from hypertrophic cardiomyopathy attributable to a sarcomeric gene mutation.
21269460 2011 Initial characterization of the human central proteome.
20965760 2011 Identification of a novel TPM1 mutation in a family with left ventricular noncompaction and sudden death.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20474083 2010 A novel custom resequencing array for dilated cardiomyopathy.
20381070 2010 Sex-specific proteome differences in the anterior cingulate cortex of schizophrenia.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20359594 2010 Clinical features and outcome of hypertrophic cardiomyopathy associated with triple sarcomere protein gene mutations.
20215591 2010 Coding sequence rare variants identified in MYBPC3, MYH6, TPM1, TNNC1, and TNNI3 from 312 patients with familial or idiopathic dilated cardiomyopathy.
20075843 2010 Polymorphisms in the tropomyosin TPM1 short isoform promoter alter gene expression and are associated with increased risk of metabolic syndrome.
20065163 2010 Molecular and functional characterization of a novel cardiac-specific human tropomyosin isoform.
20031618 2009 Prevalence of sarcomere protein gene mutations in preadolescent children with hypertrophic cardiomyopathy.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19875404 2009 The role of Lamin A/C mutations in Danish patients with idiopathic dilated cardiomyopathy.
19853701 2009 Histologic characterization of hypertrophic cardiomyopathy with and without myofilament mutations.
19820697 2009 A genome-wide meta-analysis identifies 22 loci associated with eight hematological parameters in the HaemGen consortium.
19678923 2009 Presence of activating KRAS mutations correlates significantly with expression of tumour suppressor genes DCN and TPM1 in colorectal cancer.
19646950 2009 The effect of the dilated cardiomyopathy-causing mutation Glu54Lys of alpha-tropomyosin on actin-myosin interactions during the ATPase cycle.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19509158 2009 MiR-21 indicates poor prognosis in tongue squamous cell carcinomas as an apoptosis inhibitor.
19293840 2009 The role of sarcomere gene mutations in patients with idiopathic dilated cardiomyopathy.
19222994 2009 Dilated cardiomyopathy mutations in alpha-tropomyosin inhibit its movement during the ATPase cycle.
19150014 2009 [Mutations in sarcomeric genes MYH7, MYBPC3, TNNT2, TNNI3, and TPM1 in patients with hypertrophic cardiomyopathy].
19035361 2009 Diagnostic yield, interpretation, and clinical utility of mutation screening of sarcomere encoding genes in Danish hypertrophic cardiomyopathy patients and relatives.
18937355 2008 A tropomyosin 1 induced defect in cytokinesis can be rescued by elevated expression of cofilin.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18513529 2008 Relationship between sex, shape, and substrate in hypertrophic cardiomyopathy.
18403758 2008 Shared genetic causes of cardiac hypertrophy in children and adults.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17987659 2008 Nebulette interacts with filamin C.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17932326 2007 Dilated and hypertrophic cardiomyopathy mutations in troponin and alpha-tropomyosin have opposing effects on the calcium affinity of cardiac thin filaments.
17895359 2007 DAP kinase mediates the phosphorylation of tropomyosin-1 downstream of the ERK pathway, which regulates the formation of stress fibers in response to oxidative stress.
17721995 2008 Role of high-molecular weight tropomyosins in TGF-beta-mediated control of cell motility.
17556658 2007 Dilated cardiomyopathy mutant tropomyosin mice develop cardiac dysfunction with significantly decreased fractional shortening and myofilament calcium sensitivity.
17556170 Myocardial perfusion, oxidative metabolism, and free fatty acid uptake in patients with hypertrophic cardiomyopathy attributable to the Asp175Asn mutation in the alpha-tropomyosin gene: a positron emission tomography study.
17360712 2007 The effect of mutations in alpha-tropomyosin (E40K and E54K) that cause familial dilated cardiomyopathy on the regulatory mechanism of cardiac muscle thin filaments.
16754800 2006 Single-gene mutations and increased left ventricular wall thickness in the community: the Framingham Heart Study.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16260624 2005 Exon selection in alpha-tropomyosin mRNA is regulated by the antagonistic action of RBM4 and PTB.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16130169 2005 Proteomics of human umbilical vein endothelial cells applied to etoposide-induced apoptosis.
15897890 2005 Silencing of the Tropomyosin-1 gene by DNA methylation alters tumor suppressor function of TGF-beta.
15695827 2005 The regulatory effects of tropomyosin and troponin-I on the interaction of myosin loop regions with F-actin.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15479242 2004 Effects of cardiomyopathic mutations on the biochemical and biophysical properties of the human alpha-tropomyosin.
15269838 2004 Histidine-proline rich glycoprotein (HPRG) binds and transduces anti-angiogenic signals through cell surface tropomyosin on endothelial cells.
15249230 2004 Expression of a novel cardiac-specific tropomyosin isoform in humans.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15095301 2004 Alterations in tropomyosin isoform expression in human transitional cell carcinoma of the urinary bladder.
15031138 2004 alpha-Tropomyosin mutations Asp(175)Asn and Glu(180)Gly affect cardiac function in transgenic rats in different ways.
15000344 2004 Genetics of hypertrophic cardiomyopathy in eastern Finland: few founder mutations with benign or intermediary phenotypes.
14870975 2003 What is the role of tropomyosin in the regulation of muscle contraction?
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14627618 2003 Smooth muscle contraction and relaxation.
13679858 2003 Loss of expression of tropomyosin-1, a novel class II tumor suppressor that induces anoikis, in primary breast tumors.
12974739 2003 Mutation spectrum in a large cohort of unrelated consecutive patients with hypertrophic cardiomyopathy.
12686598 2003 Extracellular signal-regulated kinase mediates phosphorylation of tropomyosin-1 to promote cytoskeleton remodeling in response to oxidative stress: impact on membrane blebbing.
12594734 2003 High-molecular-weight tropomyosins localize to the contractile rings of dividing CNS cells but are absent from malignant pediatric and adult CNS tumors.
12527301 2003 Polycystin-2 associates with tropomyosin-1, an actin microfilament component.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12473556 2002 Prevalence and severity of "benign" mutations in the beta-myosin heavy chain, cardiac troponin T, and alpha-tropomyosin genes in hypertrophic cardiomyopathy.
12065096 2002 Tropomyosin-1, a novel suppressor of cellular transformation is downregulated by promoter methylation in cancer cells.
11964245 2002 Tropomyosin requires an intact N-terminal coiled coil to interact with tropomodulin.
11840567 2002 Cluster analysis of an extensive human breast cancer cell line protein expression map database.
11563548 2001 Vertebrate tropomyosin: distribution, properties and function.
11438684 2001 Deciphering the design of the tropomyosin molecule.
11273725 2001 Mutations that alter the surface charge of alpha-tropomyosin are associated with dilated cardiomyopathy.
11136687 2001 Hypertrophic cardiomyopathy caused by a novel alpha-tropomyosin mutation (V95A) is associated with mild cardiac phenotype, abnormal calcium binding to troponin, abnormal myosin cycling, and poor prognosis.
11071908 2000 A nonerythroid isoform of protein 4.1R interacts with components of the contractile apparatus in skeletal myofibers.
10343096 1999 Refined localization of the human alpha-tropomyosin gene (TPM1) by genetic mapping.
9822100 1998 The cardiac beta-myosin heavy chain gene is not the predominant gene for hypertrophic cardiomyopathy in the Finnish population.
9108196 1997 Actin and tropomyosin isoforms in morphogenesis.
9092943 1997 Ca2+-dependent interaction of S100A2 with muscle and nonmuscle tropomyosins.
9016781 1997 Fine mapping of five human skeletal muscle genes: alpha-tropomyosin, beta-tropomyosin, troponin-I slow-twitch, troponin-I fast-twitch, and troponin-C fast.
8987992 1996 Interaction of deletion mutants of troponins I and T: COOH-terminal truncation of troponin T abolishes troponin I binding and reduces Ca2+ sensitivity of the reconstituted regulatory system.
8886980 1996 N-tropomodulin: a novel isoform of tropomodulin identified as the major binding protein to brain tropomyosin.
8523464 1995 Novel missense mutation in alpha-tropomyosin gene found in Japanese patients with hypertrophic cardiomyopathy.
8450225 1993 Autoimmunity to cytoskeletal protein tropomyosin. A clue to the pathogenetic mechanism for ulcerative colitis.
8327508 1993 A familial hypertrophic cardiomyopathy locus maps to chromosome 15q2.
8205619 1994 Alpha-tropomyosin and cardiac troponin T mutations cause familial hypertrophic cardiomyopathy: a disease of the sarcomere.
7916663 1993 Human fibroblast tropomyosin isoforms: characterization of cDNA clones and analysis of tropomyosin isoform expression in human tissues and in normal and transformed cells.
7898523 1995 Mutations in the genes for cardiac troponin T and alpha-tropomyosin in hypertrophic cardiomyopathy.
7835079 1995 Assignment of the human skeletal muscle alpha-tropomyosin gene (TPM1) to band 15q22 by fluorescence in situ hybridization.
7780795 1994 [Analysis of the diversity of tropomyosin isoforms].
7568216 1995 Specificity of dimer formation in tropomyosins: influence of alternatively spliced exons on homodimer and heterodimer assembly.
6822572 1983 Effects of troponin-I plus-C on the binding of troponin-T and its fragments to alpha-tropomyosin. Ca2+ sensitivity and cooperativity.
6746613 1984 Interactions among chymotryptic troponin T subfragments, tropomyosin, troponin I and troponin C.
3857586 1985 Renaturation of skeletal muscle tropomyosin: implications for in vivo assembly.
3611073 1987 The effects of troponin T fragments T1 and T2 on the binding of nonpolymerizable tropomyosin to F-actin in the presence and absence of troponin I and troponin C.
3548719 1987 Relation of streptococcal M protein with human and rabbit tropomyosin: the complete amino acid sequence of human cardiac alpha tropomyosin, a highly conserved contractile protein.
3336363 1988 Human hTM alpha gene: expression in muscle and nonmuscle tissue.
3336357 1988 Cloning and characterization of a cDNA encoding transformation-sensitive tropomyosin isoform 3 from tumorigenic human fibroblasts.
3138425 1988 Evolution of tropomyosin functional domains: differential splicing and genomic constraints.
2136742 1990 The amino terminus of muscle tropomyosin is a major determinant for function.
1796905 1991 The molecular basis for tropomyosin isoform diversity.
1631061 1992 Protein interaction cloning in yeast: identification of mammalian proteins that react with the leucine zipper of Jun.
278975 1978 Specific phosphorylation at serine-283 of alpha tropomyosin from frog skeletal and rabbit skeletal and cardiac muscle.