1. Home
  2. Targets
  3. p53-regulated apoptosis-inducing protein 1

Tbio p53-regulated apoptosis-inducing protein 1

May play an important role in mediating p53/TP53-dependent apoptosis.

This gene is specifically expressed in the thymus, and encodes a protein that is localized to the mitochondrion. The expression of this gene is inducible by p53, and it is thought to play an important role in mediating p53-dependent apoptosis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Oct 2011]

 Comments

Property Summary

NCBI Gene PubMed Count 19
PubMed Score 16.59
PubTator Score 8.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Alexithymia 14 3.014 1.5

Expression

  Differential Expression (6)

Disease log2 FC p
esophageal adenocarcinoma -1.100 1.8e-02
psoriasis -2.000 6.1e-04
medulloblastoma, large-cell 1.100 8.9e-04
group 3 medulloblastoma 1.100 5.5e-03
non primary Sjogren syndrome sicca -1.200 2.0e-02
Breast cancer -1.100 7.1e-32

Synonym

Accession Q9HCN2 Q6NT40 Q7Z6F7 Q9HCN0 Q9HCN1 p53AIP1
Symbols P53AIP1

Gene

TP53AIP1

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

 UniProt Keyword (6)

 GO Component (2)

 GO Process (2)

 Compartment GO Term (19)

See all...

 HCA RNA Cell Line (35)

See all...

Pathway (12)

See all...

Protein-protein Interaction (1)

UBR3  

Gene RIF (13)

PMID Text
25108434 Data indicate that p53-regulated apoptosis-inducing protein 1 (p53AIP1) inhibits the proliferation of PC-3M cells, arrests cell cycle at S/G2-M phase, decreases the abilities of invasion and migration and promotes cell apoptosis.
24316591 These studies indicate the critical role of p53AIP1 under DNA damaging stresses for cell fate determination in rheumatoid arthritis-fibroblast-like synovioctes containing the p53R248Q mutation.
22457820 large sample size of the combined cohort rejects a high-risk effect greater than 2.2 and indicates a limited role of TP53AIP1 in prostate cancer predisposition
22334068 Apak competes with p53 for binding to inhibit p53AIP1 expression.
20800603 Observational study of gene-disease association. (HuGE Navigator)
19228369 Data suggest that the combination of p53AIP1 and survivin gene expression may be a powerful tool to stratify subgroups with better or worse prognosis from the variable non-small cell lung cancer population.
18277909 Insufficient expression of p53AIP1 may play a role in gastric carcinogenesis in patients infected with H. pylori infection.
18277906 Insufficient expression of p53AIP1 may play a role in gastric carcinogenesis in patients infected with H. pylori infection.
17851056 p53AIP1 gene is important for non-small cell lung cancer progression and may be a possible prognostic marker
15657359 Roscovitine induced up-regulation of p53AIP1 protein and the depolarization of mitochondrial potential.
15004724 expression of the p53 mutant, R248Q, in liver cancer cells may enhance their drug resistance and upregulation of P-glycoprotein activity may contribute to this protective effect.
14707453 The expression of Ki67 and p53 in various forms of leukoplakia point to the increasing instability of the genome in parallel with the severity of leukoplakia.
12019168 p53AIP1 regulates the mitochondrial apoptotic pathway.

AA Sequence 

MGSSSEASFRSAQASCSGARRQGLGRGDQNLSVMPPNGRAQTHTPGWVSDPLVLGAQVHGGCRGIEALSV      1 - 70
SSGSWSSATVWILTGLGLGLSRPFLPGATVLRDRPLGSAFELSYDQKKAPLRLQ                     71 - 124
//

Text Mined References (21)

PMID Year Title
25108434 2014 [Effect of p53-regulated apoptosis-inducing protein 1 transfection on the biological characteristics of PC-3M human prostate cancer cells].
24316591 2014 Anti-apoptotic roles for the mutant p53R248Q through suppression of p53-regulated apoptosis-inducing protein 1 in the RA-derived fibroblast-like synoviocyte cell line MH7A.
23319000 2014 Genome-wide association study of monoamine metabolite levels in human cerebrospinal fluid.
22457820 2012 Prostate cancer risk is not altered by TP53AIP1 germline mutations in a German case-control series.
22334068 2012 Apak competes with p53 for direct binding to intron 1 of p53AIP1 to regulate apoptosis.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
19228369 2009 Combination of p53AIP1 and survivin expression is a powerful prognostic marker in non-small cell lung cancer.
18277909 2008 Insights in gastric carcinogenesis from Helicobacter pylori infection.
18277906 2008 Difference of p53AIP1 mRNA expression in gastric mucosa between patients with gastric cancer and chronic gastritis infected with Helicobacter pylori.
17851056 2008 p53AIP1 expression can be a prognostic marker in non-small cell lung cancer.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15657359 2005 Roscovitine-induced up-regulation of p53AIP1 protein precedes the onset of apoptosis in human MCF-7 breast cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15004724 2004 Mutant p53 expression enhances drug resistance in a hepatocellular carcinoma cell line.
14707453 2003 Changes in apoptosis and mitotic index, p53 and Ki67 expression in various types of oral leukoplakia.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12019168 2002 p53AIP1 regulates the mitochondrial apoptotic pathway.
11181995 2001 The sequence of the human genome.
11030628 2000 p53AIP1, a potential mediator of p53-dependent apoptosis, and its regulation by Ser-46-phosphorylated p53.