Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.09
PubTator Score 0.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 5.9e-11
cystic fibrosis 1696 1.7e-05
psoriasis 6694 1.0e-03
inflammatory breast cancer 286 1.7e-03

Expression

  Differential Expression (4)

Disease log2 FC p
cystic fibrosis 1.796 1.7e-05
inflammatory breast cancer 1.300 1.7e-03
osteosarcoma -3.241 5.9e-11
psoriasis -1.500 1.0e-03

AA Sequence

MDRGQPSLEPAAAAPRASGRCVIAPVRAVLRLRRRVCVLRKRRLLQPGGGPDVGTGAPRPGCSPRAPRAD      1 - 70
LDQPKFFTFDSPAELPSRTPRKKRRRSRLVLYPETSRKYRPRVEHRSRAQRCLLLLVAIVGFQVLNAIEN     71 - 140
LDDNAQRYDLDGLEKALQRAVFGQPAAVSRIVALMRDYLATHVHSRPLLLALHGPSGVGKSHVGRLLARH    141 - 210
FRSVLEDSALVLQYHARHHCPEARAAQDCREELARRVADVVARAEAEEKTPLLVLDDVELMPRPLLDELH    211 - 280
GFLQPQRSHHFHNAIYVLLSGAGGAEVTRFVLQNASRALPLRPDGFRSAEAAAAQAEEDLRASLLAVLSR    281 - 350
EHPLWQAAAIVPFLLLDKRDVVSCFRDEMAGEGFFPDQARAENLAAQLSFYRVAGREFAVTGCKQVVATV    351 - 420
NLL                                                                       421 - 423
//

Text Mined References (4)

PMID Year Title