Property Summary

NCBI Gene PubMed Count 30
PubMed Score 484.41
PubTator Score 49.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.600 4.7e-06
psoriasis -1.300 1.8e-02
osteosarcoma -1.502 3.8e-04

Gene RIF (16)

PMID Text
25200081 The results show that Topo IIIalpha stimulates DNA unwinding by BLM in a manner that is potentiated by RMI1-RMI2, and that the processivity of resection is reliant on the Topo IIIalpha-RMI1-RMI2 complex.
24526736 hTOP3alpha interacts with p53, regulates p53 and p21 expression, and contributes to the p53-mediated tumor suppression
24108125 MPS1 protein-dependent phosphorylation of RecQ-mediated genome instability protein 2 (RMI2) at serine 112 is essential for BLM-Topo III alpha-RMI1-RMI2 (BTR) protein complex function upon spindle assembly checkpoint (SAC) activation during mitosis
22672768 Study found a correlation between topoisomerase IIIalpha immunoexpression and oral squamous cell carcinoma (OSCC) cancer stem cell immunophenotypes. However, results did not show a prognostic significance of topoisomerases in OSCC>
22050635 TOP3A, a new partner gene fused to MLL in an adult patient with de novo acute myeloid leukaemia.
20445207 human topoisomerase IIIalpha functions as a decatenase with the assistance of BLM and RMI1 to facilitate the processing of homologous recombination intermediates without crossing over as a mechanism to preserve genome integrity
19742304 G-quadruplex ligand telomestatin impairs binding of topoisomerase IIIalpha to G-quadruplex-forming oligonucleotides and uncaps telomeres in ALT cells
19432957 Individuals carrying genetic variants of the BLM-TOP3A-RMI1 complex have an increased risk of acute myeloid leukemia/myelodysplatic syndromes, malignant melanoma, bladder and breast cancer.
19432957 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18418389 Topo IIIalpha is an important telomere-associated factor, essential for telomere maintenance and chromosome stability in ALT cells, and speculate on its potential mechanistic function.
18390547 evolutionarily conserved N-terminal third of BLAP75 mediates complex formation with BLM and Topo IIIalpha and that the DNA binding activity resides in the C-terminal third of this novel protein.
17728255 BLM is stably associated with TOP3A.
16595695 BLM, Topo IIIalpha, and BLAP75 constitute a dissolvasome complex that processes HR intermediates to limit DNA crossover formation
16546998 The effects of TOP3 on telomere binding in human and S. cerevisiae cells are reported.
12433984 The Bloom's syndrome helicase stimulates the activity of topoisomerase IIIalpha
12209014 Dual localization to mitochondria and nucleus

AA Sequence

MIFPVARYALRWLRRPEDRAFSRAAMEMALRGVRKVLCVAEKNDAAKGIADLLSNGRMRRREGLSKFNKI      1 - 70
YEFDYHLYGQNVTMVMTSVSGHLLAHDFQMQFRKWQSCNPLVLFEAEIEKYCPENFVDIKKTLERETRQC     71 - 140
QALVIWTDCDREGENIGFEIIHVCKAVKPNLQVLRARFSEITPHAVRTACENLTEPDQRVSDAVDVRQEL    141 - 210
DLRIGAAFTRFQTLRLQRIFPEVLAEQLISYGSCQFPTLGFVVERFKAIQAFVPEIFHRIKVTHDHKDGI    211 - 280
VEFNWKRHRLFNHTACLVLYQLCVEDPMATVVEVRSKPKSKWRPQALDTVELEKLASRKLRINAKETMRI    281 - 350
AEKLYTQGYISYPRTETNIFPRDLNLTVLVEQQTPDPRWGAFAQSILERGGPTPRNGNKSDQAHPPIHPT    351 - 420
KYTNNLQGDEQRLYEFIVRHFLACCSQDAQGQETTVEIDIAQERFVAHGLMILARNYLDVYPYDHWSDKI    421 - 490
LPVYEQGSHFQPSTVEMVDGETSPPKLLTEADLIALMEKHGIGTDATHAEHIETIKARMYVGLTPDKRFL    491 - 560
PGHLGMGLVEGYDSMGYEMSKPDLRAELEADLKLICDGKKDKFVVLRQQVQKYKQVFIEAVAKAKKLDEA    561 - 630
LAQYFGNGTELAQQEDIYPAMPEPIRKCPQCNKDMVLKTKKNGGFYLSCMGFPECRSAVWLPDSVLEASR    631 - 700
DSSVCPVCQPHPVYRLKLKFKRGSLPPTMPLEFVCCIGGCDDTLREILDLRFSGGPPRASQPSGRLQANQ    701 - 770
SLNRMDNSQHPQPADSRQTGSSKALAQTLPPPTAAGESNSVTCNCGQEAVLLTVRKEGPNRGRQFFKCNG    771 - 840
GSCNFFLWADSPNPGAGGPPALAYRPLGASLGCPPGPGIHLGGFGNPGDGSGSGTSCLCSQPSVTRTVQK    841 - 910
DGPNKGRQFHTCAKPREQQCGFFQWVDENTAPGTSGAPSWTGDRGRTLESEARSKRPRASSSDMGSTAKK    911 - 980
PRKCSLCHQPGHTRPFCPQNR                                                     981 - 1001
//

Text Mined References (36)

PMID Year Title
25200081 2014 Multifaceted role of the Topo III?-RMI1-RMI2 complex and DNA2 in the BLM-dependent pathway of DNA break end resection.
24526736 2014 DNA topoisomerase III alpha regulates p53-mediated tumor suppression.
24108125 2013 Monopolar spindle 1 (MPS1) protein-dependent phosphorylation of RecQ-mediated genome instability protein 2 (RMI2) at serine 112 is essential for BLM-Topo III ?-RMI1-RMI2 (BTR) protein complex function upon spindle assembly checkpoint (SAC) activation during mitosis.
23509288 2013 Scaffolding protein SPIDR/KIAA0146 connects the Bloom syndrome helicase with homologous recombination repair.
22672768 2012 Topoisomerase expression in oral squamous cell carcinoma: relationship with cancer stem cells profiles and lymph node metastasis.
22050635 2012 TOP3A, a new partner gene fused to MLL in an adult patient with de novo acute myeloid leukaemia.
20843780 2011 Identification of rare DNA variants in mitochondrial disorders with improved array-based sequencing.
20445207 2010 Human topoisomerase IIIalpha is a single-stranded DNA decatenase that is stimulated by BLM and RMI1.
19742304 2009 The G-quadruplex ligand telomestatin impairs binding of topoisomerase IIIalpha to G-quadruplex-forming oligonucleotides and uncaps telomeres in ALT cells.
19432957 2009 Association between polymorphisms in RMI1, TOP3A, and BLM and risk of cancer, a case-control study.
18923083 2008 BLAP18/RMI2, a novel OB-fold-containing protein, is an essential component of the Bloom helicase-double Holliday junction dissolvasome.
18923082 2008 RMI, a new OB-fold complex essential for Bloom syndrome protein to maintain genome stability.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18418389 2008 Topoisomerase IIIalpha is required for normal proliferation and telomere stability in alternative lengthening of telomeres.
18390547 2008 Functional role of BLAP75 in BLM-topoisomerase IIIalpha-dependent holliday junction processing.
17728255 2007 Holliday junction processing activity of the BLM-Topo IIIalpha-BLAP75 complex.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16595695 2006 A double Holliday junction dissolvasome comprising BLM, topoisomerase IIIalpha, and BLAP75.
16546998 2006 Involvement of topoisomerase III in telomere-telomere recombination.
15775963 2005 BLAP75, an essential component of Bloom's syndrome protein complexes that maintain genome integrity.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12433984 2002 The Bloom's syndrome helicase stimulates the activity of human topoisomerase IIIalpha.
12209014 2002 Dual localization of human DNA topoisomerase IIIalpha to mitochondria and nucleus.
11997338 2002 Genes in a refined Smith-Magenis syndrome critical deletion interval on chromosome 17p11.2 and the syntenic region of the mouse.
11406610 2001 Evidence for BLM and Topoisomerase IIIalpha interaction in genomic stability.
10945498 2000 Expression of topoisomerase IIIalpha in normal and neoplastic tissues determined by immunohistochemistry using a novel monoclonal antibody.
10739669 2000 Differential expression of human topoisomerase IIIalpha during the cell cycle progression in HL-60 leukemia cells and human peripheral blood lymphocytes.
10734115 2000 The Bloom's syndrome gene product interacts with topoisomerase III.
10728666 2000 Association of the Bloom syndrome protein with topoisomerase IIIalpha in somatic and meiotic cells.
10710432 2000 Human RecQ5beta, a large isomer of RecQ5 DNA helicase, localizes in the nucleoplasm and interacts with topoisomerases 3alpha and 3beta.
10352172 1999 Purification and characterization of human DNA topoisomerase IIIalpha.
9748294 1998 Cloning and characterization of the 5'-flanking region for the human topoisomerase III gene.
9114025 1997 Overexpression of a truncated human topoisomerase III partially corrects multiple aspects of the ataxia-telangiectasia phenotype.
8622991 1996 Human TOP3: a single-copy gene encoding DNA topoisomerase III.