Property Summary

NCBI Gene PubMed Count 317
PubMed Score 662.28
PubTator Score 609.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Asthma 349 0.0 2.0
Disease Target Count Z-score Confidence
Cancer 2346 5.276 2.6

Expression

Gene RIF (268)

PMID Text
26867764 The study is an open label, single arm, phase II study, investigating the efficacy of epirubicin in patients with oxaliplatin refractory colorectal cancer and with a cancer cell TOP2A/CEN-17 ratio >/= 1.5
26657567 Deletion or deficiency of PTEN leads to down regulation of TOP2A, dysfunction of the decatenation checkpoint and incomplete DNA decatenation in G2 and M phases.
26643143 PICH and Topo II cooperate to prevent chromosome missegregation events in mitosis.
26612825 during early development, TOP2A is likely to have a role in cell proliferation, whereas TOP2B is expressed in post-mitotic cells and may be important in controlling expression of long genes even at this early stage.
26588239 may be a useful biomarker in patients receiving adjuvant taxane-platinum regimens with moderate- to high-risk endometrial cancer
26560244 These studies revealed a relationship between TOP2A and androgen receptor signaling pathway that contributes to prostate cancer progression and confers sensitivity to treatments.
26252353 TUBB3, TOP2A, CYP19A1 and CYP2D6 gene expression, but not protein expression, was associated with patient survival in breast cancer .
26221582 b-ELE could inhibit the proliferation of HepG-2 cells and interfere with the expression and activity of TOPO I and TOPO IIa
26100858 Data show that TOP2A gene gain and protein over-expression might predict activity of PLD in platinum resistant/refractory EOC.
26081617 It might, therefore, be concluded that topoisomerase II enzyme may be involved in the repair of radiation-induced DNA damage and consequently its inhibition constitute a strategy for sensitizing tumour cells to ionizing radiation.
26046674 JWA and topoisomerase II alpha regulate each other in tumor cells arrested in G2/M.
26022247 Report allelic imbalance at the HER2/TOP2A locus in breast cancer.
25931012 No TOP2A copy number changes were found in patients with de novo diffuse large B-cell lymphoma or relapsed DLBCL treated with chemotherapy regimens including TOP2-targeting drugs.
25921160 TOP2A expression was higher in gastric cancer from elderly patients compared to gastrointestinal tumors from young patients.
25846735 prognostic significance of either TOP2A expression or TOP2A gene changes in breast cancer and its various subtypes is limited.
25846551 Mutation in TOP2A gene is associated with epithelial ovarian cancer growth and drug resistance.
25777966 Topoisomerase-1 and -2A gene copy numbers are elevated in mismatch repair-proficient colorectal cancers.
25769404 Protein expression of BIRC5, TK1, and TOP2A in malignant peripheral nerve sheath tumours--A prognostic test after surgical resection.
25762097 TOPBP1 has a role in recruiting TOP2A to ultra-fine anaphase bridges to aid in their resolution
25695068 TOP2A gene amplification was not observed.
25657202 In ACC, the DNA topoisomerase TOP2A was associated with significantly poorer overall and disease-free survival.
25605014 Patients screened for Top2a and Ezh2 expression would exhibit significant response to a combinational treatment involving low dose etoposide combined with Ezh2 inhibition.
25586498 Activity of quinolone CP-115,955 against bacterial and human type II topoisomerases is mediated by different interactions.
25550836 Combined detection of MDR-related proteins ToPo II, MRP and GST-pi may be prospectively valuable for postoperative individualized chemotherapy, and further predict the outcomes of gastric cancer patients.
25521189 DNA damage-triggered ATF3 controlled p53 accumulation and generation of double-strand breaks may serve as a switch between DNA damage and cell death following TOP2A inhibitor treatment.
25451918 UHRF1 interacts with TopoIIalpha and regulates its localization to hemimethylated DNA. TopoIIalpha decatenates the hemimethylated DNA following replication, which might facilitate the methylation of the nascent strand by DNMT1
25432700 expression was not only associated with poorer differentiation and perineural invasion, but it could also act as an independent prognostic factor in patients with esophageal squamous cell carcinoma
25372714 These results demonstrated that NPRL-Z-1 appeared to be a novel TOP2 poison and ROS generator. Thus, NPRL-Z-1 may present a significant potential anticancer candidate against renal carcinoma.
25304659 Low topoisomerase II expression is associated with chemotherapy resistance in gastric cancer.
25280269 Data suggest that ability to distinguish supercoil handedness of DNA is embedded within catalytic core of TOP2A; N-terminal gate domain of TOP2A interacts with topoisomerase II inhibitors.
25237769 This study demonstrates that TOP2Ahigh is the phenotype of recurrence/metastasis but TOP2Aneg cells show slow cycling and have cancer stem cell properties in prostate cancer, which has significant implications for prostate cancer therapy.
25098819 TOP2A FISH and qPCR may not identify the same pathology on chr17q. Non-HER2 chr17 CN patterns may further predict outcome in breast cancer patients with known favorable and unfavorable prognosis.
25042383 the TOP2A gene alterations may play an important role in determining anthracycline sensitivity in breast cancer
24919264 TopoII alpha content in lung adenocarcinoma is an independent prognostic factor. Mutual research of TopoII alpha with clinical and morphological parameters and Ag-NOR has prognostic value in lung adenocarcinoma.
24808172 Proteolytic degradation of Top2 enables the processing of Top2.DNA and Top2.RNA covalent complexes by TDP2.
24695359 Data suggest that TOP2A hydrolysis of neoplastic DNA in the presence of ATP can be inhibited by salicylate analogs; molecular models suggest this inhibition is dependent on structure of salicylates/antineoplastic agents included in this study.
24682655 No TOP2A amplification occurred without HER2 co-amplification in an analysis of breast cancer in tissue microarrays from a clinical cohort study.
24675496 Based on TOP2A expression, there was no significant difference in disease-free survival in the breast cancer patients who received anthracycline and taxane-containing adjuvant chemotherapy.
24658003 Chromosome breakage by TOP2 is an endogenous threat to gene transcription and to normal neuronal development and maintenance.
24637229 TOP2 is highly expressed in proneural gliomas, rendering its pharmacological targeting by intratumoral administration of etoposide by convection-enhanced delivery effective on murine proneural gliomas.
24630889 MCM2/TOP2A immunohistochemistry can help to support a diagnosis of true dysplasia for patients without a history of head and neck cancer.
24626180 Topoisomerase IIalpha, an enzyme essential for resolution of DNA replication intermediates, binds telomeres in a TRF1-mediated manner.
24624938 The surexpression of topoisomerase II alpha was associated within increased tumor stage.
24476913 Results show that topoisomerase II alpha function during late G2 and M-phase is truly required for shaping mitotic chromosomes.
24403186 In breast neoplasms TOP2A copy number change was strongly associated with hormone receptor and HER2 status and as a prognostic marker TOP2A is probably of limited value.
24388441 Higher TOPOIIa expression is independently associated with increased risk of cancer death among patients undergoing surgery for clear cell renal cell carcinoma.
24349352 NFBD1/MDC1 is phosphorylated by PLK1 and controls G2/M transition through the regulation of a TOPOIIalpha-mediated decatenation checkpoint.
24327541 The study shows TOP2B-dependent increase in the number of nuclei displaying juxtaposed RUNX1 and RUNX1T1 loci following etoposide treatment.
24244448 Top2alpha is the major isoform mediating the replication-dependent mechanism and both Top2alpha and Top2 mediate the transcription-dependent mechanism.
24185119 The imunohistochemical staining for topoisomerase IIalpha expression might be useful as additional marker for mucosal dysplasia degree determination
24138107 TOP2A gene gain was a frequent finding in colorectal cancer specimens with 9.8 % having a total of >/=4 TOP2A copies per cell. No prognostic characteristic of TOP2A was identified.
24135250 The mRNA expression level of STMN1, TOP2A and ERCC1 are correlated with non-small cell lung carcinoma pathology type in Chinese patients.
24130054 homologous recombination seems relevant especially for Top1 and, to a lesser extent, for Top2 inhibitors. We also found and discuss differential pathways among Top1 inhibitors and Top2 inhibitors
24040417 DNA topoisomerases I and II are involved in initiating APH-induced common fragile site breakage at RET
23956975 high Topo II- alpha could be identified as reliable predicators for the clinical behavior of giant cell lesion .
23900272 These results suggest that decreases in cell proliferation due to genistein may result from the inhibition of cellular topo II and that genistein, a major soy isoflavone, may be an anticancer food component
23897556 TOP2A overexpression significantly correlates with more advanced AJCC stages and independently predicts worse DSS and DMFS.
23860238 MCM 7, geminin and topo IIalpha can be reliable tools for the differential diagnosis of reactive mesothelial cells and malignant mesothelioma cells.
23850692 LRIG1 inhibits EGFR expression and the downstream signaling activation, interferes with Bcl-2/Topo-2 expressions and eventually sensitizes glioma cells to TMZ
23698369 studies indicate that the ability of TOP2A to prevent DNA entanglement at mitosis requires BAF complexes and suggest that this activity contributes to the role of BAF subunits as tumour suppressors
23533247 TOP2A is highly overexpressed in adrenocortical carcinoma and regulates cellular proliferation, invasion, and anchorage-independent growth in adrenocortical carcinoma cells.
23508957 Mechanistic basis for chiral discrimination and explanation for the effects of DNA twist and tension on eukaryotic type IIA topoisomerases.
23473851 Topo IIalpha, together with HER-2, might help to select for patients who could benefit from anthracycline-based neoadjuvant chemotherapy and identify non-complete responders at a higher risk of disease recurrence or death.
23399433 HIV-1 RT co-localizes with TOP2A and TOP2B in cytosol of HIV-1 infected Sup T1 and PBMC cells
23399433 Knockdown of TOP2A, TOP2B, or TOP2A/2B by siRNA significantly decreases HIV-1 replication in Sup T1 cells
23398928 show that TOP2A gene copy number alterations are not observed in this type of tumor. So, higher protein expression of TOP2A is not related to gene amplification in prostate cancer
23388101 Report topoisomerase II alpha expression in ovarian serous carcinoma.
23349762 Data indicate that STK295900 inhibited DNA relaxation activity of topoisomerase 1 and 2 (Top 1 and 2).
23214297 Report topoisomerase I, topoisomerase IIalpha and p53 protein expression in relation to the progressive growth of ovarian tumors.
23163762 ATM-dependent TOP2A modification is required for proper regulation of TOP2 stability.
23135572 In untreated patients, Ki67, TOP2A, and RacGAP1 are significant and independent prognostic markers.
23020778 Two (XRCC5 and TOP2A) of seven DNA repair and replication proteins studied were prognostic for melanoma.
22871798 A high gene dosage of TOP2A determined using qPCR occurs frequently both in HER-2(+) and HER-2(-) tumors and has a strong adverse prognostic impact.
22864769 TOP2A amplification is related to anthracycline-based neoadjuvant chemotherapy sensitivity.
22841979 The principal site of DNA engagement undergoes highly quantized conformational transitions between distinct binding, cleavage, and drug-inhibited states that correlate with the control of subunit-subunit interactions.
22730815 Msx2 and topo II-alpha may play an important role in the occurrence and development of sinonasal inverted papilloma.
22706628 TOP2A expression was significantly associated with recurrence in estrogen receptor positive, HER2 negative breast cancer.
22679013 Probing conformational changes in human DNA topoisomerase IIalpha by pulsed alkylation mass spectrometry.
22672768 Topoisomerase IIalpha immunoexpression in oral squamous cell carcinomas showed a positive correlation with p53 expression, indicating that tumors negative to this topoisomerase show no signs of p53 inactivation.
22569122 Topo-IIalpha may be a novel marker of cell proliferation and/or survival factor in glioblastoma cancer stem cells
22563370 The active DNA topoisomerase II alpha is significantly less abundant at the centromeres of BLM-deficient cells and PICH-deficient cells than at those of control cells.
22555090 Amplification of Her-2/neu and/or topoisomerase IIalpha is associated with poor overall survival in breast cancer.
22496876 The results showed that human topoisomerase IIalpha unlinks a DNA braid of crossing angles ~90; and under ~1 pN of tension in bursts of ~0.5 mm or ~10 turns, each taking ~10 s.
22452920 Data suggest that microRNA/mRNA pairs in hsa-miR-140-3p/RAD51AP1/, hsa-miR-145/E2F3, hsa-miR-139-5p/TOP2A, and hsa-miR-133a/GCLC were correlated with ovarian tumorigenesis.
22426810 Analyzed the occurrence of TOP2A gene amplification and chromosome 17 polysomy in patients with early breast cancer.TOP2A amplification correlated with shorter disease-free survival and shorter overall survival.
22375014 Our findings reveal a broad involvement of Tdp1 in DNA repair and clarify the role of human TDP1 in the repair of Top2-induced DNA damage.
22374418 Review of some of the published studies addressing the predictive value of TOP2A as well as the cellular functions of this enzyme and its status in breast cancer tissue.
22323612 The accurate cleavage of DNA by topoisomerase II is regulated through a tight coordination with DNA bending.
22300273 Loss of topoisomerase (DNA) II alpha is associated with liposarcoma.
22281973 HER-2/neu and TOPIIa are over expressed in gastric tumors and may promote disease progression.
22240029 This study confirms the favorable prognostic value of HER2/TOP2A co-amplification.
22203181 High TOP2A expression is associated with soft tissue sarcomas.
22190034 HIV-1 RT co-localizes with TOP2A and TOP2B in cytosol of HIV-1 infected Sup T1 and PBMC cells
22168383 Classical lobular breast carcinoma consistently lacks topoisomerase-IIalpha gene amplification.
22160858 Conclude that EndoG and TOPO2a may actively participate in apoptotic chromatin degradation.
22153616 Amplification of HER2 and deletion of TOP2A were frequently observed in tumors with a high ploidy level.
22076611 Topo IIalpha expression is a valuable prognostic indicator for colorectal cancer.
21917518 Meta-analysis: HER2 amplification and TOP2A amplification/deletion may have some value in the prediction of responsiveness to anthracycline-based chemotherapy, but our findings do not support the use of anthracyclines only in these patients.
21880040 Topoisomerase IIalpha (topo IIalpha) protein expression has prognostic significance in many cancers. However, it is still unclear whether topo IIalpha protein expression and gene alterations play roles as prognostic factors in diffuse large B-cell lymphoma (DLBCL)
21878638 a new paradigm in which p38gamma actively regulates the drug-Topo IIalpha signal transduction, and this may be exploited to increase the therapeutic activity of Topo II drugs.
21875466 TOP2A gene expression was significantly associated with the metastasis-free interval in the breast cancer patients.
21768308 HuR enhances TOP2A translation by competing with miR-548c-3p; their combined actions control TOP2A expression levels and determine the effectiveness of doxorubicin.
21761866 Data show that citrinin trimer tricitinol B inhibited topo IIalpha-mediated supercoiled DNA relaxation.
21734419 The expression of TOP2A was not related to the amplification of the TOP2A gene or the HER2 status of the tumor. The expression of TOP2A was an independent predictor of pathologically complete remission.
21705665 Results indicate that amplification of TOP2A in breast cancer is not confined to those who are concomitantly HER-2/neu(+), and suggest that a significant proportion of HER-2/neu(-) patients exhibit high levels of TOP2A.
21681601 TOP2A expression was studied in adjuvant dose-dense anthracycline treated breast cancers . Survival was longer in TOP2A-positive cases than TOP2A-negative,& was more favourable in the ER/PR-negative and TOP2A-positive tumours than in other subgroups.
21667123 Expression of ER, HER2, and TOP2A displayed discordance with a sufficient frequency to emphasize the role of confirmatory biopsies from metastatic lesions in future management of recurrent breast cancer.
21629784 Findings define a MKI67, TOP2A, and E2F1 tri-marker proliferation index with possible utility for improved prognostication and treatment stratification in prostate cancer.
21614903 The expression of TOP2A correlated with higher histologic grade, tumor size and negative progestin receptor expression in breast carcinomas.
21595939 found that geminin and TopoIIalpha interact primarily in G2/M/early G1 cells on chromosomes, that geminin recruits TopoIIalpha to chromosomal decatenation sites or vice versa and that geminin silencing in mammary epithelial cells triggers formation of chromosome bridges by suppressing TopoIIalpha access to chromosomal arms
21519837 TOP2A gene alterations and HER2 protein overexpression were each associated with responsiveness to anthracycline-containing chemotherapy in breast cancer.
21506336 Topoisomerase IIalpha activity and tumor cell proliferation level from the degree of bromodeoxyuridine label in uterine body leiomyosarcoma
21461646 Expression and amplification of Topoisomerase-2alpha in type 1 and type 2 papillary renal cell carcinomas are correlated with HER2/neu amplification.
21455636 High DNA topoisomerase II alpha in metastatic cells are associated with response to therapy in small cell lung cancer.
21450455 Topo2A has a role in chemosensitivity, and ERCC1 has a role in survival in locally advanced soft tissue sarcomas
21435434 TOP2A expression in breast cancer has a role in high proliferation and aggressive tumor subtypes
21288332 In HER2-amplified breast cancer, the subgroup of patients with hormone receptor-negative cancer and without TOP2A amplification presents the highest risk of recurrence.
21252292 Overexpression of miR-485-3p reduces expression of nuclear factor-YB and corresponding up-regulation of DNA topoisomerase IIalpha expression.
21229879 Examine inhibition of DNA topoisomerases I and II by G3 PAMAM-NH2 dendrimer-modified digoxin and proscillaridin A conjugates in a cell free system.
21189395 TOP2A coamplification, not HER2 amplification, is the clinically useful predictive marker of an incremental response to anthracycline-based chemotherapy.
21126478 Hydroquinone could repress the expression of TOPOIIalpha in human bone marrow mononuclear cells.
21067592 TopIIalpha may have a role in survival for postoperative NSCLC patients who received adjuvant chemotherapy
21062978 Data show that the prognostic abilities of TOP2A and MIB-1 were significantly better in ERG(-) patients.
20824055 Topoisomerase II-mediatedTopoisomerase II-mediated DNA damage is differently repaired during the cell cycle by non-homologous end joining and homologous recombination is differently repaired during the cell cycle.
20813715 TOP2A plays an important role in the invasion and metastasis of colorectal carcinoma.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20709174 This study reports a method for the rapid over-expression and purification of active GST-tagged human topoisomerase IIalpha using the baculovirus mediated insect cell expression system.
20697251 In vulvar squamous epithelium and its associated lesions, proliferation markers such as TOP2A and Ki-67were found to be useful for vulvar squamous lesions.
20688355 cystic carcinomas of the breast have low Topo IIalpha expression but frequently overexpress EGFR protein without EGFR gene amplification.
20655466 TRF2, which binds preferentially to positively supercoiled DNA substrates, together with Apollo, negatively regulates the amount of TOP1, TOP2alpha, and TOP2beta at telomeres.
20557373 HER-2/neu and TOPOIIalpha amplification/overexpression might discriminate between Barrett's oesophagus, dysplasia and adenocarcinoma.
20497003 High levels of topoisomerase IIalpha protein expression in diffuse large B-cell lymphoma are associated with high proliferation, germinal center immunophenotype, and response to treatment.
20441774 TOP2A gene dosage was shown to be a potent prognostic factor in breast cancer
20422488 The expression of ToPo II, MRP and GST-pi is associated with the efficacy of postoperative adjuvant chemotherapy of gastric carcinoma.
20369487 The expression of COX-2 was correlated with the expression of P-gp and Topo II alpha significantly in gastrointestinal carcinomas.
20194637 Data show that mitotic chromatin is heavily self-entangled through experiments in which topoisomerase (topo) II is observed to reduce mitotic chromosome elastic stiffness.
20184667 ProExC expression is not associated with HPV in squamous cell carcinoma in situ of the skin
20170164 Data show that naphthalimide-based antitumor agents were proved to inhibit topoisomerase II (topo II).
20130985 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20130985 TOP2A gene amplification may define a subset of HER2-amplified breast cancers that are responsible for the markedly improved chemosensitivity seen in HER2-positive breast cancer.
20089371 the TOP2A/CEP17 ratio may be a useful predictor of the effects of anthracycline-based neoadjuvant chemotherapy in breast cancer.
20079182 Blocking the Topo II alpha gene expression by RNAi in cisplatin-resistant epithelial ovarian cancer cells reverses drug resistance.
20029472 Increased topoisomerase II alpha is associated with prostatic carcinoma.
20021828 A negative correlation was observed between over-expression of TOPIIalpha and lymph node metastasis in gastric adenocarcinoma.
19956635 Uncategorized study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19956605 Silencing of Bmi1 inhibits drug-induced Top2alpha degradation, increases the persistence of Top2alpha-DNA cleavage complex, and increases Top2 drug efficacy.
19945923 simple co-amplification is not the main mechanism leading to patients with both ERBB2 and TOP2A aberrations and the term simultaneous amplification is more precise. ERBB2 amplification is of higher level than TOP2A amplification.
19913893 Enhanced expression of TOP-2alpha is positively associated with a high rate of recurrence and progression in Non-Muscle-Invasive Bladder Cancer.
19886180 Topoisomerase II alpha is a fundamental prognostic factor in breast carcinoma.
19885609 analysis of topoisomerase IIalpha expression in acute myeloid leukaemia cells that survive after exposure to daunorubicin or ara-C
19729798 promising biomarker of metastatic breast cancer survival and potential marker of resistance to CMF therapy.
19713842 Studies indicate that neither HER-2 status nor topoisomerase IIalpha status can be considered clinically valuable in guiding prescription of anthracyclines.
19697956 four acidic amino acid residues interact with metal ions in the DNA cleavage/ligation active site
19695223 These results demonstrate that Elongin B/C-cullin 2-VHL protein complex acts as E3 ubiquitin ligase targeting glucose-regulated destruction domain-independent topo IIalpha to the ubiquitin-proteasome pathway.
19670699 TOPIIA was strongly expressed in most cases of synovial sarcomas with no change in gene amplification after treatment.
19661040 In a phase II trial of a neoadjuvant platinum-containing regimen for locally advanced breast cancer, overexpression of topo IIalpha was correlated with pathologic complete response (P < .001).
19661031 The majority of leiomyosarcomas had expression of topoisomerase IIalpha
19620488 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19582575 over-expressed in 4 pancreatic adenocarcinoma cases out of 13
19539329 Topoisomerase II alpha is over expressed in 85% of renal medullary carcinomas, potentially supporting the use of topoisomerase II alpha inhibitor agents to treat this aggressive renal tumor
19485418 observations demonstrate that the QTK loop is an important player for the interdomain communication in human topoisomerase IIalpha
19454010 HIV-1 RT co-localizes with TOP2A and TOP2B in cytosol of HIV-1 infected Sup T1 and PBMC cells
19428368 Suppression of topoisomerase IIalpha in human hTERT-RPE1 cells causes a reduction in frequency of chromatid breaks in radiation-exposed cells.
19401546 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19401546 TOP2A gene alterations (amplifications or deletions) are associated with an increase in responsiveness to anthracycline-containing chemotherapy relative to non-anthracycline regimens that is similar to that seen in patients with HER2 amplification
19329795 TEP1, TOPOIIalpha, and HSP90 interact directly with BLM in vitro and modulate its helicase activity on telomere-like DNA substrates but not on non-telomeric substrates.
19270648 Top IIalpha overexpression is involved in the progression of ovarian cancer
19223331 Results suggest a mechanism of up-regulation of cellular expression of topo IIalpha by HMGB1/2 in pRb-negative cells by modulation of binding of transcription factor NF-Y to the topo IIalpha promoter.
19222228 Data show a difference in metal ion utilization during DNA cleavage mediated by human topoisomerase IIalpha and IIbeta.
19185918 Significantly higher DNA topoisomerase IIalpha is associated with relapse in acute lymphocytic leukemia.
19111388 Topoisomerase IIalpha overexpression is significantly associated with alterations in tumor behavior and response to drug treatment in colorectal cancer.
19098900 These results reveal an important role of Topo II in checkpoint activation and in the maintenance of genomic stability.
19080257 HER2 and Topo IIalpha overexpression could be predictors of the response to neoadjuvant chemotherapy in both the CEF and CMF arms.
19074885 Observational study of gene-disease association. (HuGE Navigator)
19061514 increase in both gene expression and gene copy number in Chinese patients with gastric carcinoma; gene amplification is associated with HER2 gene amplification
19053267 Clusters of positively charged amino acid residues in human topoisomerase II alpha are required for the enzyme to distinguish supercoil geometry during DNA relaxation; deletion of even the most C-terminal cluster abrogates this recognition.
19019771 findings suggest that high Topo II-alpha expression may be a useful indicator of tumor aggressiveness and poor outcome in laryngeal squamous cell carcinoma.
19003983 expressions correlated with advance histological grading, microvascular invasion, and an early age onset of the malignancy
18927283 Overexpression of topoisomerase IIalpha is associated with barrett's esophagus-associated high-grade dysplasia.
18824850 Somatostatin could induce cell cycle arrest in S phase and upregulate Topo IIalpha expression in gallbladder cancer cells
18824478 The topoisomerase IIalpha introduces a single-stranded break at the hairpin loop formed by alpha satellite DNA in a reaction, where DNA ligation is partly uncoupled from the cleavage reaction.
18815879 The reported poorer response to chemotherapeutic agents in patients with Metaplastic breast carcinomas may stem from downregulated DNA damage response pathways, PTEN and TOP2A.
18702822 TOP2A deletion is associated with poor prognosis in ERBB2-amplified breast carcinomas.
18653531 Critical interaction with the 3'-bridging atom of the scissile phosphate greatly accelerates rates of topoisomerase IIalpha-mediated DNA cleavage.
18632987 APC has a role in the G2/M transition, potentially through association with topo IIalpha
18596031 NK314 acts as a Top2alpha-specific poison in mammalian cells, with excellent potential as an efficacious and safe chemotherapeutic agent.
18544048 topoII-alpha could be a independent prognostic factor for a putative malignant transformation
18520795 ERCC1 was confirmed to be an independent prognostic factor for survival in LD patients. No significant role was found for ERCC1, RRM1 and TopoIIalpha in ED patients.
18465341 Analysis of TOP2A aberrations suggests a differential benefit of adjuvant chemotherapy in patients with primary breast cancer, favoring treatment with epirubicin in patients with TOP2A amplifications, and perhaps deletions.
18402387 gliomas immunohistochemically express Topo-IIalpha that is correlated with PCNA expression, and which is significantly less frequent in long survivors
18347177 TopoIIalpha was an independent adverse predictor of failure-free survival in Hodgkin's lymphoma.
18332872 First detailed genome-wide characterisation of HER2/TOP2A-amplified breast cancers. The 17q12 amplicon is complex and harbours multiple genes that may be associated with breast cancer development and progression, and potentially therapeutic targets.
18204862 topoisomerase IIalpha might be an effective chemotherapeutic target in advanced gallbladder carcinoma
18171681 Plk1-dependent phosphorylation regulates functions of DNA topoisomerase IIalpha in cell cycle progression
18162055 Data suggest that ubiquitination of topoisomerase IIalpha is dependent on oxidative stress, and that BRCA1 may be involved in the ubiquitination.
18062778 topoisomerase IIalpha is a novel physiological substrate for Plk3, and Plk1 and Plk3 play different roles in cell-cycle regulation.
18045852 A three-dimensional quantitative structure-activity analysis of a new class of bisphenol TOP2A inhibitors is described.
17998154 NK314 inhibited topoisomerase II activity and stabilized topoisomerase II-DNA cleavable complexes.
17983804 Topo IIalpha interacts with beta-catenin/T-cell factor-4 as a novel transcriptional co-activator in colorectal neoplasms.
17956945 The sensitivity to depletion of topo IIalpha might be linked to structural alterations within the centromere domain, indicated by shortening of the distance across metaphase sister centromeres and persistence of PICH-coated connections.
17922046 TOP2A status cannot be predicted from the HER-2 status and evaluation of the TOP2A status only in patients with HER-2 overexpression may lead to missing cases with TOP2A deletion with possible resistance to therapy in breast neoplasms.
17717428 polysomy of chromosome 17 does not affect the ERBB2 expression and topoisomerase IIalpha mRNA expression is not related to gene status
17636313 The ability of HMGB1 to interact with topoisomerase IIalpha and promote topoisomerase IIalpha binding to DNA suggests a mechanism by which HMGB1 stimulates the catalytic activity of the enzyme via enhancement of DNA cleavage.
17607373 The difference in DNA topoisomerase alpha labeling index between the low- and highgrade esthesioneuroblastoma was not statistically significant, but it was suggestive of a positive association.
17526531 The C-terminal region of human topoisomerase II alpha determines its isoform-specific functions in proliferating cells.
17512033 Immunoreactivity for p16, MCM2, and TOP IIA was detected in only 76% of cases in low-grade squamous epitelial lesions (LSIL-s).
17453369 40 breast carcinomas from BRCA1 mutation carriers and 40 sporadic breast carcinomas were examined for HER-2 and TOP2A amplification status
17410335 There was a strong linear positive correlation between MCM6 label index and DNA Topo II alpha label index in the craniopharyngiomas studied.
17361331 Topo IIalpha and beta mRNA expression, but not the Topo IIalpha labeling index, might be a useful marker for sensitivity to etoposide in human malignant neuroepithelial tumors.
17289897 HIF-1alpha is inhibited by NSC 644221 in a process that is topoisomerase II-dependent
17212588 During early mitosis, protein phosphatase 2A was translocated from the nucleus, while CK2 remained in the nucleus until pro-metaphase thus permitting the formation of the mitotic protein monoclonal 2 phosphoepitope
17182034 We conclude that topo II alpha and beta nuclear export is inhibited in proliferating cells so that these proteins do not shuttle.
17072627 topo IIalpha is a proliferation and also an apoptotic marker in atrophic OLP lesions and it might have a predictive value in oral lichen planus lesions prone to develop malignancy
16990717 over-expression of topoisomerase IIalpha is significantly associated with progression from cervical neoplasm CIN2 to CIN3, being a late marker of cell proliferation
16864174 The purpose of this study was to evaluate amplification of topoisomerase IIalpha (TOP2A) genes as predictors of response to chemotherapy in advanced breast cancer. TOP2A gene amplification was present in 14 cases (16%).
16712776 Topoisomerase II alpha and beta isoforms are present in the pre-integration complexes, suggesting their significant role in HIV-1 replication.
16682295 5/6 neuroblastoma cell lines contained 17q translocations, but the TOP2A gene was included in the translocated genetic material in only one of the cell lines. TOP2A gene dosage does not correlate with topoisomerase IIalpha protein expression level.
16611985 PKCdelta regulates topoisomerase IIalpha and thereby cell fate in the genotoxic stress response.
16533774 Increased TopoII expression after neoadjuvant anthracycline-based chemotherapy is associated with relapses in breast tumors
16533424 TOP2A mRNA and protein expression in ovarian cancer exhibits specific patterns in tumor epithelial and adjacent stromal cells, which are differentially modulated after platinum-based chemotherapy
16507781 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16271071 INER-37 cell line is the first cancer cell line reported with an innate mutation affecting the 3'-end region of the topo II alpha gene that confers a cytoplasmic localization of the enzyme and therefore an increased resistance to etoposide
16234514 Topoisomerase IIa amplifications and deletions are associated with the efficacy of epirubicin in the adjuvant setting of breast cancer patients
16213649 Data suggests that the alpha(2)HTH module once separated from the whole protein conserves a compact conformation, integral to specific dimerization and DNA recognition.
16188892 topoisomerase IIalpha relaxes positively supercoiled plasmids >10-fold faster than negatively supercoiled molecules
16139951 Observational study of gene-disease association. (HuGE Navigator)
16114891 C-terminal domain of human topoisomerase IIalpha appears to play significant roles in modulating the DNA cleavage/ligation reaction of the enzyme and its response to anticancer agents.
16091284 Further analysis of purified virus showed that HIV-1 virion contained topoisomerase II isoform-specific kinase activities, which were partially isolated
16053917 We show that a R162K mutation in human topoisomerase II alpha renders this enzyme highly resistant towards vanadate while having little effect on bisdioxopiperazine sensitivity.
15899781 topo2a and HER-2 status might have therapeutic and prognostic implications.
15809708 low-level amplification of TIIalpha gene locus may be sporadic mechanism of increased TIIalpha protein expression in pediatric non-brainstem glioma, which can coincide with low-level amplification of Her-2/neu
15602006 Cisplatin was shown to strongly inhibit the decatenation and relaxation activity of isolated human DNA topoisomerase IIalpha.
15491148 Human topoisomerase II alpha appears to ligate the two scissile bonds of a DNA cleavage site in a nonconcerted fashion.
15456904 topoIIalpha plays an essential catalytic role in chromosome segregation that cannot be complemented by topoIIbeta
15375522 Increased expression of DNA topoisomerase II alpha is associated with female breast cancer
15201855 review commentary on TOP2A as a proliferation marker, indicator of drug sensitivity, and prognostic factor in mantle cell lymphoma
15182198 1,4-benzoquinone stimulated DNA cleavage by topoisomerase IIalpha in cultured human cells
15126503 topo IIalpha destabilization depends on the newly identified domain, GRDD (glucose-regulated destruction domain), which was mapped to the N-terminal 70-170 amino acid sequence
15044480 UVA-modified DNA is preferentially targeted and processed by topoisomerase IIalpha and IIbeta.
15037624 alterations in the ATP binding domain of the enzyme are capable of altering the interactions of TOP2A with DNA
14996935 Chromosomes were condensed and aligned at metaphase in topo IIalpha-knockdown cells.
14991576 overexpression of topoisomerase (DNA) II alpha is associated with gastric cancer
14989736 Topo-II alpha is a useful marker for diagnosing liposarcoma.
14978217 Topoisomerase IIalpha activity concentrates at heterochromatin during interphase and mitosis.
14632727 Amplification and deletion of topoisomerase IIalpha gene (TOP2A) is common in breast neoplasms and may account for both sensitivity and resistance to topoII-inhibitor-chemotherapy.
14596941 demonstrated that neither A or B isoform has any preference for a specific DNA conformation as substrate under the conditions used in these experiments
14566826 data suggest that HER-2 amplifications are frequently linked to alterations of the TOP2A gene in bladder cancer
12859955 Results suggest that topo IIalpha-depleted cells with the droplet-like nuclear structure induce apoptosis, which is dependent on caspase and p53 activity during the G1 phase in mammalian cells.
12821127 topoisomerase II is actively exported from the nuclease and is mediated by a CRM1-dependent pathway
12691917 induction of topoisomerase IIalpha expression by peroxisome proliferator-activated receptor gamma ligands via DR1-like site is an important mechanism for the enhancement of etoposide-induced apoptosis
12646941 Analysis of TOP2A gene amplification and gene overexpression in newly diagnosed childhood ALL cases and inverse correlation with glucocorticoid resistance
12646164 Thr792 in human TOP2 alpha is involved in enzyme catalysis
12569090 Phosphorylation of serine 1106 in the catalytic domain of this enzyme regulates enzymatic activity and drug sensitivity.
12480934 A heterodimer of this protein with only one ATP binding site can go through successive catalytic cycles
12429910 promoter elements responsible for transcriptional inhibition of polo-like kinase 1 and topoisomerase IIalpha genes by p21(WAF1/CIP1/SDI1)
12429800 Topo IIalpha may provide crucial information regarding selection of adenohypophyseal tumors responsive to antineoplastic therapy, such as invasive pituitary adenomas and pituitary carcinomas, which exhibit a high Topo IIalpha index.
12429798 Topoisomerase II-alpha expression in rectal epithelium has a significant circadian variation and giving topoisomerase II-targeted chemotherapeutic agents at the proper time of day might reduce their mucositis side effects.
12356743 Co-localizes with centromere activity and proteins within a subdomain of the major human X chromosome array
12237772 presence of dna topoisomerase II in different testicular tumor types
12079377 The ATP-operated clamp of human DNA topoisomerase IIalpha: model for DNA-dependent ATPase activity.
12078518 Redox control of cell cycle-coupled topoisomerase II alpha gene expression
12014628 Transcriptional regulation of the human topoisomerase IIalpha gene
12001123 Overexpression of topoisomerase IIalpha induced by mutant p53 is associated with aggressive carcinogenesis in non-small cell lung carcinoma
11958416 Topoisomerase II alpha represents a reliable alternative to monoclonal antibody MIB-1 as a proliferation marker in human meningiomas.
11940566 The role of topoisomerase II in the excision of DNA loop domains during apoptosis.
11927602 topo II is not an immobile, structural component of the chromosomal scaffold or the interphase karyoskeleton, but rather a dynamic interaction partner of such structures.
11862483 increased expression appears to be part of malignant cells' phenotype in recurrent colon cancers
11444988 The heat-induced transition of TOP2A requires both Mg2+ and DNA, is stable for several hours and leads to loss of DNA strand activity. A second transition correlates with a drop in the level of DNA scission, followed by religation at high temperatures.

AA Sequence

MEVSPLQPVNENMQVNKIKKNEDAKKRLSVERIYQKKTQLEHILLRPDTYIGSVELVTQQMWVYDEDVGI      1 - 70
NYREVTFVPGLYKIFDEILVNAADNKQRDPKMSCIRVTIDPENNLISIWNNGKGIPVVEHKVEKMYVPAL     71 - 140
IFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETASREYKKMFKQTWMDNMGRAGEMELKPFN    141 - 210
GEDYTCITFQPDLSKFKMQSLDKDIVALMVRRAYDIAGSTKDVKVFLNGNKLPVKGFRSYVDMYLKDKLD    211 - 280
ETGNSLKVIHEQVNHRWEVCLTMSEKGFQQISFVNSIATSKGGRHVDYVADQIVTKLVDVVKKKNKGGVA    281 - 350
VKAHQVKNHMWIFVNALIENPTFDSQTKENMTLQPKSFGSTCQLSEKFIKAAIGCGIVESILNWVKFKAQ    351 - 420
VQLNKKCSAVKHNRIKGIPKLDDANDAGGRNSTECTLILTEGDSAKTLAVSGLGVVGRDKYGVFPLRGKI    421 - 490
LNVREASHKQIMENAEINNIIKIVGLQYKKNYEDEDSLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHN    491 - 560
WPSLLRHRFLEEFITPIVKVSKNKQEMAFYSLPEFEEWKSSTPNHKKWKVKYYKGLGTSTSKEAKEYFAD    561 - 630
MKRHRIQFKYSGPEDDAAISLAFSKKQIDDRKEWLTNFMEDRRQRKLLGLPEDYLYGQTTTYLTYNDFIN    631 - 700
KELILFSNSDNERSIPSMVDGLKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSSYHHGEMSLMMTIIN    701 - 770
LAQNFVGSNNLNLLQPIGQFGTRLHGGKDSASPRYIFTMLSSLARLLFPPKDDHTLKFLYDDNQRVEPEW    771 - 840
YIPIIPMVLINGAEGIGTGWSCKIPNFDVREIVNNIRRLMDGEEPLPMLPSYKNFKGTIEELAPNQYVIS    841 - 910
GEVAILNSTTIEISELPVRTWTQTYKEQVLEPMLNGTEKTPPLITDYREYHTDTTVKFVVKMTEEKLAEA    911 - 980
ERVGLHKVFKLQTSLTCNSMVLFDHVGCLKKYDTVLDILRDFFELRLKYYGLRKEWLLGMLGAESAKLNN    981 - 1050
QARFILEKIDGKIIIENKPKKELIKVLIQRGYDSDPVKAWKEAQQKVPDEEENEESDNEKETEKSDSVTD   1051 - 1120
SGPTFNYLLDMPLWYLTKEKKDELCRLRNEKEQELDTLKRKSPSDLWKEDLATFIEELEAVEAKEKQDEQ   1121 - 1190
VGLPGKGGKAKGKKTQMAEVLPSPRGQRVIPRITIEMKAEAEKKNKKKIKNENTEGSPQEDGVELEGLKQ   1191 - 1260
RLEKKQKREPGTKTKKQTTLAFKPIKKGKKRNPWSDSESDRSSDESNFDVPPRETEPRRAATKTKFTMDL   1261 - 1330
DSDEDFSDFDEKTDDEDFVPSDASPPKTKTSPKLSNKELKPQKSVVSDLEADDVKGSVPLSSSPPATHFP   1331 - 1400
DETEITNPVPKKNVTVKKTAAKSQSSTSTTGAKKRAAPKGTKRDPALNSGVSQKPDPAKTKNRRKRKPST   1401 - 1470
SDDSDSNFEKIVSKAVTSKKSKGESDDFHMDFDSAVAPRAKSVRAKKPIKYLEESDEDDLF            1471 - 1531
//

Text Mined References (340)

PMID Year Title
26867764 2016 A phase II study of Epirubicin in oxaliplatin-resistant patients with metastatic colorectal cancer and TOP2A gene amplification.
26657567 2015 PTEN stabilizes TOP2A and regulates the DNA decatenation.
26643143 2015 PICH promotes sister chromatid disjunction and co-operates with topoisomerase II in mitosis.
26612825 2016 Distinct expression patterns for type II topoisomerases IIA and IIB in the early foetal human telencephalon.
26588239 2016 Evaluation of TOP2A as a Predictive Marker for Endometrial Cancer With Taxane-Containing Adjuvant Chemotherapy.
26560244 2015 Topoisomerase 2 Alpha Cooperates with Androgen Receptor to Contribute to Prostate Cancer Progression.
26252353 2015 RRM1, TUBB3, TOP2A, CYP19A1, CYP2D6: Difference between mRNA and protein expression in predicting prognosis of breast cancer patients.
26221582 2015 ?-Elemene Inhibits Cell Proliferation by Regulating the Expression and Activity of Topoisomerases I and II? in Human Hepatocarcinoma HepG-2 Cells.
26100858 2015 TOP2A gene copy gain predicts response of epithelial ovarian cancers to pegylated liposomal doxorubicin: TOP2A as marker of response to PLD in ovarian cancer.
26081617 2015 Inhibition of topoisomerase II? sensitizes FaDu cells to ionizing radiation by diminishing DNA repair.
26046674 2015 EGCG regulates the cross-talk between JWA and topoisomerase II? in non-small-cell lung cancer (NSCLC) cells.
26022247 2015 Allelic imbalance at the HER2/TOP2A locus in breast cancer.
25931012 2015 Lack of topoisomerase copy number changes in patients with de novo and relapsed diffuse large B-cell lymphoma.
25921160 2015 Sensitivity of gastric cancer cells to chemotherapy drugs in elderly patients and its correlation with cyclooxygenase-2 expression.
25846735 2015 Clinical significance of topoisomerase 2A expression and gene change in operable invasive breast cancer.
25846551 2015 Profiling cancer gene mutations in longitudinal epithelial ovarian cancer biopsies by targeted next-generation sequencing: a retrospective study.
25777966 2015 Topoisomerase-1 and -2A gene copy numbers are elevated in mismatch repair-proficient colorectal cancers.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25769404 2015 Protein expression of BIRC5, TK1, and TOP2A in malignant peripheral nerve sheath tumours--A prognostic test after surgical resection.
25762097 2015 TOPBP1 recruits TOP2A to ultra-fine anaphase bridges to aid in their resolution.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25695068 2015 TOP2A amplification and overexpression in hepatocellular carcinoma tissues.
25657202 2015 Immunohistochemical validation of overexpressed genes identified by global expression microarrays in adrenocortical carcinoma reveals potential predictive and prognostic biomarkers.
25605014 2015 Top2a identifies and provides epigenetic rationale for novel combination therapeutic strategies for aggressive prostate cancer.
25586498 2015 Activity of quinolone CP-115,955 against bacterial and human type II topoisomerases is mediated by different interactions.
25550836 2014 Significance of multidrug resistance gene-related proteins in the postoperative chemotherapy of gastric cancer.
25521189 2015 The catalytic topoisomerase II inhibitor dexrazoxane induces DNA breaks, ATF3 and the DNA damage response in cancer cells.
25451918 2015 Topoisomerase II regulates the maintenance of DNA methylation.
25432700 2015 Topo2A as a prognostic biomarker for patients with resectable esophageal squamous cell carcinomas.
25372714 2014 NPRL-Z-1, as a new topoisomerase II poison, induces cell apoptosis and ROS generation in human renal carcinoma cells.
25304659 2014 Expression of multidrug resistance-associated proteins and their relation to postoperative individualized chemotherapy in gastric cancer.
25280269 2014 Catalytic core of human topoisomerase II?: insights into enzyme-DNA interactions and drug mechanism.
25237769 2014 TOP2Ahigh is the phenotype of recurrence and metastasis whereas TOP2Aneg cells represent cancer stem cells in prostate cancer.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25202966 2014 Structure of the N-terminal Gyrase B fragment in complex with ADP?Pi reveals rigid-body motion induced by ATP hydrolysis.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
25098819 2014 Adjusting breast cancer patient prognosis with non-HER2-gene patterns on chromosome 17.
25042383 2014 Topoisomerase II-alfa gene as a predictive marker of response to anthracyclines in breast cancer.
24919264 2014 [Topoisomerase IIa expression in correlation with clinical and morphological parameters and proliferation (based on argyrophilic proteins of nucleolar organizer regions and Ki-67 antigen) in lung adenocarcinoma].
24808172 2014 Proteolytic degradation of topoisomerase II (Top2) enables the processing of Top2·DNA and Top2·RNA covalent complexes by tyrosyl-DNA-phosphodiesterase 2 (TDP2).
24695359 2014 Structural determinants of the catalytic inhibition of human topoisomerase II? by salicylate analogs and salicylate-based drugs.
24682655 2014 HER2 and TOP2A amplification in a hospital-based cohort of breast cancer patients: associations with patient and tumor characteristics.
24675496 Topoisomerase II alpha and microtubule-associated protein-tau as a predictive marker in axillary lymph node positive breast cancer.
24658003 2014 TDP2 protects transcription from abortive topoisomerase activity and is required for normal neural function.
24637229 2014 Convection-enhanced delivery of etoposide is effective against murine proneural glioblastoma.
24630889 2014 MCM2/TOP2A (ProExC) immunohistochemistry as a predictive marker in head and neck mucosal biopsies.
24626180 2014 TopoII? prevents telomere fragility and formation of ultra thin DNA bridges during mitosis through TRF1-dependent binding to telomeres.
24624938 2014 Expression of topoisomerase II alpha, ki67, and p53 in primary non-muscle-invasive urothelial bladder carcinoma.
24476913 2014 The ? isoform of topoisomerase II is required for hypercompaction of mitotic chromosomes in human cells.
24403186 2014 TOP2A gene copy number change in breast cancer.
24388441 2014 Higher expression of topoisomerase II alpha is an independent marker of increased risk of cancer-specific death in patients with clear cell renal cell carcinoma.
24349352 2013 NFBD1/MDC1 is phosphorylated by PLK1 and controls G2/M transition through the regulation of a TOPOII?-mediated decatenation checkpoint.
24327541 2014 The role of topoisomerase II beta on breakage and proximity of RUNX1 to partner alleles RUNX1T1 and EVI1.
24244448 2013 Replication-dependent and transcription-dependent mechanisms of DNA double-strand break induction by the topoisomerase 2-targeting drug etoposide.
24185119 2014 The value of immunohistochemical determination of topoisomerase II? and Ki67 as markers of cell proliferation and malignant transformation in colonic mucosa.
24138107 2013 Underpinning the repurposing of anthracyclines towards colorectal cancer: assessment of topoisomerase II alpha gene copy number alterations in colorectal cancer.
24135250 2013 Association between clinical pathology and multiple genes mRNA expression in Chinese patients with NSCLC.
24130054 2014 Differential and common DNA repair pathways for topoisomerase I- and II-targeted drugs in a genetic DT40 repair cell screen panel.
24040417 2013 DNA topoisomerases participate in fragility of the oncogene RET.
23956975 2013 Detection of the Epstein-Barr virus and DNA-topoisomerase II- ? in recurrent and nonrecurrent giant cell lesion of the jawbones.
23900272 2013 Inhibitory effects of a major soy isoflavone, genistein, on human DNA topoisomerase II activity and cancer cell proliferation.
23897556 2014 TOP2A overexpression as a poor prognostic factor in patients with nasopharyngeal carcinoma.
23860238 2013 Differential diagnosis of reactive mesothelial cells and malignant mesothelioma cells using the cell proliferation markers minichromosome maintenance protein 7, geminin, topoisomerase II alpha and Ki-67.
23850692 2013 LRIG1 dictates the chemo-sensitivity of temozolomide (TMZ) in U251 glioblastoma cells via down-regulation of EGFR/topoisomerase-2/Bcl-2.
23698369 2013 BAF complexes facilitate decatenation of DNA by topoisomerase II?.
23533247 2013 TOP2A is overexpressed and is a therapeutic target for adrenocortical carcinoma.
23508957 2013 Chiral discrimination and writhe-dependent relaxation mechanism of human topoisomerase II?.
23473851 2013 The predictive and prognostic significance of pre- and post-treatment topoisomerase II? in anthracycline-based neoadjuvant chemotherapy for local advanced breast cancer.
23398928 2013 Prognostication of prostate cancer based on TOP2A protein and gene assessment: TOP2A in prostate cancer.
23388101 2013 P53, MAPK, topoisomerase II alpha and Ki67 immunohistochemical expression and KRAS/BRAF mutation in ovarian serous carcinomas.
23349762 2013 STK295900, a dual inhibitor of topoisomerase 1 and 2, induces G(2) arrest in the absence of DNA damage.
23214297 The association between the p53/topoisomerase I and p53/ topoisomerase IIalpha immunophenotypes and the progression of ovarian carcinomas.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23163762 2013 Ataxia telangiectasia mutated-dependent regulation of topoisomerase II alpha expression and sensitivity to topoisomerase II inhibitor.
23135572 2013 Validity of the proliferation markers Ki67, TOP2A, and RacGAP1 in molecular subgroups of breast cancer.
23022727 2012 Structure of a topoisomerase II-DNA-nucleotide complex reveals a new control mechanism for ATPase activity.
23020778 2013 DNA repair and replication proteins as prognostic markers in melanoma.
22871798 2012 Prognostic significance of TOP2A gene dosage in HER-2-negative breast cancer.
22864769 2012 TOP2A amplification in breast cancer is a predictive marker of anthracycline-based neoadjuvant chemotherapy efficacy.
22841979 2012 The structure of DNA-bound human topoisomerase II alpha: conformational mechanisms for coordinating inter-subunit interactions with DNA cleavage.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22730815 2012 [Expression and significance of Msx2 and topo II-alpha in sinonasal inverted papilloma].
22706628 2012 TOP2A RNA expression and recurrence in estrogen receptor-positive breast cancer.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22679013 2012 Probing conformational changes in human DNA topoisomerase II? by pulsed alkylation mass spectrometry.
22672768 2012 Topoisomerase expression in oral squamous cell carcinoma: relationship with cancer stem cells profiles and lymph node metastasis.
22569122 2012 Quantitative analysis of topoisomerase II alpha and evaluation of its effects on cell proliferation and apoptosis in glioblastoma cancer stem cells.
22563370 2012 Bloom's syndrome and PICH helicases cooperate with topoisomerase II? in centromere disjunction before anaphase.
22555090 2012 Her-2/neu and topoisomerase II? in advanced breast cancer: a comprehensive FISH analysis of 245 cases.
22496876 2012 Direct observation of strand passage by DNA-topoisomerase and its limited processivity.
22452920 2012 Identifying microRNA/mRNA dysregulations in ovarian cancer.
22426810 2012 Prognostic value of TOP2A gene amplification and chromosome 17 polysomy in early breast cancer.
22375014 2012 Tyrosyl-DNA phosphodiesterase 1 (TDP1) repairs DNA damage induced by topoisomerases I and II and base alkylation in vertebrate cells.
22374418 2012 Topoisomerase 2 alpha: a real predictor of anthracycline efficacy?
22323612 2012 DNA cleavage and opening reactions of human topoisomerase II? are regulated via Mg2+-mediated dynamic bending of gate-DNA.
22300273 2012 Clinicopathologic study of E-cadherin/beta-catenin complex, and topoisomerase-II in a series of 71 liposarcoma cases.
22281973 2012 HER-2/neu and TOPIIa expression in gastric cancer reflect disease severity.
22240029 2012 HER2 and TOP2A in high-risk early breast cancer patients treated with adjuvant epirubicin-based dose-dense sequential chemotherapy.
22203181 2012 Prognostication of soft tissue sarcomas based on chromosome 17q gene and protein status: evaluation of TOP2A, HER-2/neu, and survivin.
22168383 2012 Classical lobular breast carcinoma consistently lacks topoisomerase-II? gene amplification: implications for the tailored use of anthracycline-based chemotherapies.
22160858 2012 Endonuclease G interacts with histone H2B and DNA topoisomerase II alpha during apoptosis.
22153616 2012 Lack of independent prognostic and predictive value of centromere 17 copy number changes in breast cancer patients with known HER2 and TOP2A status.
22111588 2011 Maternal topoisomerase II alpha, not topoisomerase II beta, enables embryonic development of zebrafish top2a-/- mutants.
22076611 2012 DNA topoisomerase II alpha: a favorable prognostic factor in colorectal caner.
22013166 2012 RECQL5 cooperates with Topoisomerase II alpha in DNA decatenation and cell cycle progression.
21917518 2011 HER2 and TOP2A as predictive markers for anthracycline-containing chemotherapy regimens as adjuvant treatment of breast cancer: a meta-analysis of individual patient data.
21880040 2012 Topo II? gene alterations correlated with survival in patients with diffuse large B-cell lymphoma.
21878638 2011 Phosphorylation and stabilization of topoisomerase II? protein by p38? mitogen-activated protein kinase sensitize breast cancer cells to its poisons.
21875466 2011 [Correlation of TOP2A gene expression and survival of breast cancer patients].
21768308 2011 Translational control of TOP2A influences doxorubicin efficacy.
21761866 2011 Unprecedented citrinin trimer tricitinol B functions as a novel topoisomerase II? inhibitor.
21734419 2011 Tumor topoisomerase II alpha status and response to anthracycline-based neoadjuvant chemotherapy in breast cancer.
21705665 2011 TOP2A amplification in the absence of that of HER-2/neu: toward individualization of chemotherapeutic practice in breast cancer.
21681601 2012 Tumour topoisomerase II alpha protein expression and outcome after adjuvant dose-dense anthracycline-based chemotherapy.
21667123 2012 ER, HER2, and TOP2A expression in primary tumor, synchronous axillary nodes, and asynchronous metastases in breast cancer.
21629784 2011 A tri-marker proliferation index predicts biochemical recurrence after surgery for prostate cancer.
21614903 2011 The value of TOP2A, EZH2 and paxillin expression as markers of aggressive breast cancer: relationship with other prognostic factors.
21595939 2011 Geminin overexpression prevents the completion of topoisomerase II? chromosome decatenation, leading to aneuploidy in human mammary epithelial cells.
21519837 2011 Topoisomerase II alpha protein and responsiveness of breast cancer to adjuvant chemotherapy with CEF compared to CMF in the NCIC CTG randomized MA.5 adjuvant trial.
21506336 [Topoisomerase IIalpha activity and tumor cell proliferation level from the degree of bromodeoxyuridine label in uterine body leiomyosarcoma].
21461646 2011 Expression and amplification of Topoisomerase-2? in type 1 and type 2 papillary renal cell carcinomas and its correlation with HER2/neu amplification.
21455636 2011 Expressions of topoisomerase II? and BCRP in metastatic cells are associated with overall survival in small cell lung cancer patients.
21450455 2011 Topoisomerase II-alpha protein expression and histological response following doxorubicin-based induction chemotherapy predict survival of locally advanced soft tissues sarcomas.
21435434 2011 Assessment of Topoisomerase II ? status in breast cancer by quantitative PCR, gene expression microarrays, immunohistochemistry, and fluorescence in situ hybridization.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21288332 2011 Quantification and clinical relevance of gene amplification at chromosome 17q12-q21 in human epidermal growth factor receptor 2-amplified breast cancers.
21269460 2011 Initial characterization of the human central proteome.
21252292 2011 Novel regulation of nuclear factor-YB by miR-485-3p affects the expression of DNA topoisomerase II? and drug responsiveness.
21229879 Inhibition of DNA topoisomerases I and II by G3 PAMAM-NH2 dendrimer-modified digoxin and proscillaridin A conjugates in a cell free system.
21189395 2011 Alteration of topoisomerase II-alpha gene in human breast cancer: association with responsiveness to anthracycline-based chemotherapy.
21126478 2010 [Effect of hydroquinone on expression of topoisomerase enzyme II? in human bone marrow mononuclear cells].
21067592 2010 Topoisomerase II alpha expression and the benefit of adjuvant chemotherapy for postoperative patients with non-small cell lung cancer.
21062978 2010 The ability of biomarkers to predict systemic progression in men with high-risk prostate cancer treated surgically is dependent on ERG status.
20824055 2010 Topoisomerase II-mediated DNA damage is differently repaired during the cell cycle by non-homologous end joining and homologous recombination.
20813715 2010 [Expression of topoisomerase II alpha in human colorectal carcinoma and its significance].
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20709174 2011 High-yield production and characterization of biologically active GST-tagged human topoisomerase II? protein in insect cells for the development of a high-throughput assay.
20697251 2010 Immunohistochemical patterns of ProEx C in vulvar squamous lesions: detection of overexpression of MCM2 and TOP2A.
20688355 2010 Adenoid cystic carcinomas of the breast have low Topo II? expression but frequently overexpress EGFR protein without EGFR gene amplification.
20655466 2010 TRF2 and apollo cooperate with topoisomerase 2alpha to protect human telomeres from replicative damage.
20557373 2010 TOPOIIalpha and HER-2/neu overexpression/amplification in Barrett's oesophagus, dysplasia and adenocarcinoma.
20497003 2010 High levels of topoisomerase IIalpha protein expression in diffuse large B-cell lymphoma are associated with high proliferation, germinal center immunophenotype, and response to treatment.
20457750 2010 Metnase promotes restart and repair of stalled and collapsed replication forks.
20441774 2010 Clinical evaluation of developed PCR-based method with hydrolysis probes for TOP2A copy number evaluation in breast cancer samples.
20422488 2010 [Significance of multidrug resistance gene-associated proteins in the postoperative adjuvant chemotherapy for gastric carcinoma and the prognosis].
20369487 2010 [Relationship of cyclooxygenase-2 and multidrug resistance associated factors to chemosensitivities in gastrointestinal carcinomas].
20194637 2010 Mitotic chromosomes are constrained by topoisomerase II-sensitive DNA entanglements.
20184667 2010 Expression profiles of ProEx C and Ki67 in squamous cell carcinoma in situ of the skin and their relationship with human papillomavirus genotypes.
20170164 2010 A new class of naphthalimide-based antitumor agents that inhibit topoisomerase II and induce lysosomal membrane permeabilization and apoptosis.
20130985 2010 Association between HER2, TOP2A, and response to anthracycline-based preoperative chemotherapy in high-risk primary breast cancer.
20089371 2010 The topoisomerase II alpha gene status in primary breast cancer is a predictive marker of the response to anthracycline-based neoadjuvant chemotherapy.
20079182 2009 [Inhibition of Topo II alpha gene expression and reversing of drug resistance in multi-drug resistant epithelial ovarian cancer cells induced by RNA interference in vitro].
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20029472 2008 Immunohistochemical expression of topoisomerase II alpha and Her-2/neu in prostatic carcinoma and benign prostatic hyperplasia.
20021828 2009 [Correlation between aneuploidy of chromosome 17, over-expression of TP53 and TOPIIalpha, and the clinicopathological features and diagnosis of gastric adenocarcinoma].
19956635 2009 Fulfilling the promise of personalized medicine? Systematic review and field synopsis of pharmacogenetic studies.
19956605 2009 The E3 ubiquitin-ligase Bmi1/Ring1A controls the proteasomal degradation of Top2alpha cleavage complex - a potentially new drug target.
19945923 2010 Aberrations of ERBB2 and TOP2A genes in breast cancer.
19913893 2010 Clinical implications and prognostic values of topoisomerase-II alpha expression in primary non-muscle-invasive bladder cancer.
19886180 2009 Topoisomerase II alpha--a fundamental prognostic factor in breast carcinoma.
19885609 2009 Topoisomerase IIalpha expression in acute myeloid leukaemia cells that survive after exposure to daunorubicin or ara-C.
19729798 2009 Metastatic breast cancer survival according to HER2 and Topo2a gene status.
19713842 2009 Predicting anthracycline benefit: have we made any progress?
19697956 2009 Metal ion interactions in the DNA cleavage/ligation active site of human topoisomerase IIalpha.
19695223 2009 Regulation of DNA topoisomerase IIalpha stability by the ECV ubiquitin ligase complex.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19670699 2009 Her2, EGFR and TOPIIA gene amplification and protein expression in synovial sarcoma before and after combined treatment.
19661040 2009 A phase II trial of a neoadjuvant platinum regimen for locally advanced breast cancer: pathologic response, long-term follow-up, and correlation with biomarkers.
19661031 2009 Expression of E-cadherin, beta-catenin and topoisomerase IIalpha in leiomyosarcomas.
19620488 2009 Outcome of patients with early-stage breast cancer treated with doxorubicin-based adjuvant chemotherapy as a function of HER2 and TOP2A status.
19582575 2009 HER-2/neu and topoisomerase-II-alpha expression and genic amplification in pancreatic adenocarcinoma.
19539329 2009 Topoisomerase II alpha status in renal medullary carcinoma: immuno-expression and gene copy alterations of a potential target of therapy.
19485418 2009 The QTK loop is essential for the communication between the N-terminal atpase domain and the central cleavage--ligation region in human topoisomerase IIalpha.
19428368 2009 Suppression of topoisomerase IIalpha expression and function in human cells decreases chromosomal radiosensitivity.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19401546 2009 Topoisomerase II alpha and responsiveness of breast cancer to adjuvant chemotherapy.
19390626 2009 Metnase mediates resistance to topoisomerase II inhibitors in breast cancer cells.
19329795 2009 Telomerase-associated protein 1, HSP90, and topoisomerase IIalpha associate directly with the BLM helicase in immortalized cells using ALT and modulate its helicase activity using telomeric DNA substrates.
19270648 2009 Topoisomerase IIalpha mRNA and protein expression in ovarian carcinoma: correlation with clinicopathological factors and prognosis.
19223331 2009 HMGB1 and HMGB2 proteins up-regulate cellular expression of human topoisomerase IIalpha.
19222228 2009 Use of divalent metal ions in the dna cleavage reaction of human type II topoisomerases.
19185918 2009 Level of DNA topoisomerase IIalpha mRNA predicts the treatment response of relapsed acute leukemic patients.
19111388 2009 Increased topoisomerase IIalpha expression in colorectal cancer is associated with advanced disease and chemotherapeutic resistance via inhibition of apoptosis.
19098900 2009 Topoisomerase IIalpha controls the decatenation checkpoint.
19080257 2008 HER2 and topoisomerase IIalpha: possible predictors of response to neoadjuvant chemotherapy for breast cancer patients.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
19061514 2008 Analysis of EGFR, HER2, and TOP2A gene status and chromosomal polysomy in gastric adenocarcinoma from Chinese patients.
19053267 2008 Bimodal recognition of DNA geometry by human topoisomerase II alpha: preferential relaxation of positively supercoiled DNA requires elements in the C-terminal domain.
19043076 2009 Casein kinase I delta/epsilon phosphorylates topoisomerase IIalpha at serine-1106 and modulates DNA cleavage activity.
19019771 2008 Expression of human DNA Topoisomerase II-alpha in squamous cell carcinoma of the larynx and its correlation with clinicopathologic variables.
19003983 2009 TOP2A overexpression in hepatocellular carcinoma correlates with early age onset, shorter patients survival and chemoresistance.
18927283 2008 Expression analysis of Barrett's esophagus-associated high-grade dysplasia in laser capture microdissected archival tissue.
18824850 2008 Somatostatin elevates topoisomerase II alpha and enhances the cytotoxic effect of doxorubicin on gallbladder cancer cells.
18824478 2008 Hairpin structures formed by alpha satellite DNA of human centromeres are cleaved by human topoisomerase IIalpha.
18815879 2009 Metaplastic breast carcinomas are basal-like breast cancers: a genomic profiling analysis.
18790802 2008 The SET and transposase domain protein Metnase enhances chromosome decatenation: regulation by automethylation.
18702822 2008 Topoisomerase II alpha gene copy loss has adverse prognostic significance in ERBB2-amplified breast cancer: a retrospective study of paraffin-embedded tumor specimens and medical charts.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18653531 2008 Human topoisomerase IIalpha uses a two-metal-ion mechanism for DNA cleavage.
18632987 2008 Interaction between tumor suppressor adenomatous polyposis coli and topoisomerase IIalpha: implication for the G2/M transition.
18596031 2008 NK314, a topoisomerase II inhibitor that specifically targets the alpha isoform.
18544048 Human topoisomerase II-alpha is highly expressed in sinonasal-inverted papilloma, but not in inflammatory polyp.
18520795 2008 Excision repair cross complementing-1 and topoisomerase IIalpha gene expression in small-cell lung cancer patients treated with platinum and etoposide: a retrospective study.
18465341 2008 The value of TOP2A gene copy number variation as a biomarker in breast cancer: Update of DBCG trial 89D.
18402387 DNA topoisomerase II-alpha as a proliferation marker in human gliomas: correlation with PCNA expression and patient survival.
18394993 2008 Resolution of sister centromeres requires RanBP2-mediated SUMOylation of topoisomerase IIalpha.
18347177 2008 Topoisomerase IIalpha expression as an independent prognostic factor in Hodgkin's lymphoma.
18332872 2008 Genomic analysis of the HER2/TOP2A amplicon in breast cancer and breast cancer cell lines.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18204862 2008 Upregulation of topoisomerase IIalpha expression in advanced gallbladder carcinoma: a potential chemotherapeutic target.
18171681 2008 Plk1-dependent phosphorylation regulates functions of DNA topoisomerase IIalpha in cell cycle progression.
18162055 2008 BRCA1-mediated ubiquitination inhibits topoisomerase II alpha activity in response to oxidative stress.
18062778 2008 Plk3 phosphorylates topoisomerase IIalpha at Thr(1342), a site that is not recognized by Plk1.
18045852 2008 A three-dimensional quantitative structure-activity analysis of a new class of bisphenol topoisomerase IIalpha inhibitors.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17998154 2008 NK314, a novel topoisomerase II inhibitor, induces rapid DNA double-strand breaks and exhibits superior antitumor effects against tumors resistant to other topoisomerase II inhibitors.
17983804 2007 Functional interaction of DNA topoisomerase IIalpha with the beta-catenin and T-cell factor-4 complex.
17956945 2007 Depletion of topoisomerase IIalpha leads to shortening of the metaphase interkinetochore distance and abnormal persistence of PICH-coated anaphase threads.
17924679 2007 Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.
17922046 2007 HER-2, TOP2A and chromosome 17 alterations in breast cancer.
17717428 2007 Does polysomy of chromosome 17 have a role in ERBB2 and topoisomerase IIalpha expression? Gene, mRNA and protein expression: a comprehensive analysis.
17636313 2007 HMGB1 interacts with human topoisomerase IIalpha and stimulates its catalytic activity.
17607373 2007 Esthesioneuroblastoma - a clinicopathologic study and role of DNA topoisomerase alpha.
17567603 2007 Nuclear interactions of topoisomerase II alpha and beta with phospholipid scramblase 1.
17526531 2007 C-terminal regions of topoisomerase IIalpha and IIbeta determine isoform-specific functioning of the enzymes in vivo.
17512033 2007 Evaluation of p16INK4a, minichromosome maintenance protein 2, DNA topoisomerase IIalpha, ProEX C, and p16INK4a/ProEX C in cervical squamous intraepithelial lesions.
17453369 2007 Amplification of TOP2A and HER-2 genes in breast cancers occurring in patients harbouring BRCA1 germline mutations.
17410335 2007 Expression of human MCM6 and DNA Topo II alpha in craniopharyngiomas and its correlation with recurrence of the tumor.
17388661 2007 Exquisite sensitivity of TP53 mutant and basal breast cancers to a dose-dense epirubicin-cyclophosphamide regimen.
17361331 2007 Enhanced expression of DNA topoisomerase II genes in human medulloblastoma and its possible association with etoposide sensitivity.
17289897 2007 Cell type-specific, topoisomerase II-dependent inhibition of hypoxia-inducible factor-1alpha protein accumulation by NSC 644221.
17212588 2007 Mitosis-specific MPM-2 phosphorylation of DNA topoisomerase IIalpha is regulated directly by protein phosphatase 2A.
17182034 2007 Topoisomerase II binds importin alpha isoforms and exportin/CRM1 but does not shuttle between the nucleus and cytoplasm in proliferating cells.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17072627 2007 Immunohistochemical study on topoisomerase IIalpha, Ki-67 and cytokeratin-19 in oral lichen planus lesions.
16990717 2006 Over-expression of topoisomerase IIalpha is related to the grade of cervical intraepithelial neoplasia (CIN) and high-risk human papillomavirus (HPV), but does not predict prognosis in cervical cancer or HPV clearance after cone treatment.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16914642 2006 Salvicine functions as novel topoisomerase II poison by binding to ATP pocket.
16864174 2006 TOP2A and HER2 gene amplification as predictors of response to anthracycline treatment in breast cancer.
16712776 2006 A study of the topoisomerase II activity in HIV-1 replication using the ferrocene derivatives as probes.
16682295 2006 Translocations of 17q21 approximately qter in neuroblastoma cell lines infrequently include the topoisomerase IIalpha gene.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16611985 2006 Protein kinase C delta activates topoisomerase IIalpha to induce apoptotic cell death in response to DNA damage.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16533774 2006 Changes of topoisomerase IIalpha expression in breast tumors after neoadjuvant chemotherapy predicts relapse-free survival.
16533424 2006 Altered expression pattern of topoisomerase IIalpha in ovarian tumor epithelial and stromal cells after platinum-based chemotherapy.
16507781 2006 Genomic polymorphisms provide prognostic information in intermediate-risk acute myeloblastic leukemia.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16271071 2005 Characterization of human NSCLC cell line with innate etoposide-resistance mediated by cytoplasmic localization of topoisomerase II alpha.
16236267 2005 Proteomic analysis of SUMO4 substrates in HEK293 cells under serum starvation-induced stress.
16234514 2005 retrospective analysis of topoisomerase IIa amplifications and deletions as predictive markers in primary breast cancer patients randomly assigned to cyclophosphamide, methotrexate, and fluorouracil or cyclophosphamide, epirubicin, and fluorouracil: Danish Breast Cancer Cooperative Group.
16213649 Self-association and DNA binding properties of the human topoisomerase IIA alpha2HTH module.
16188892 2005 Human topoisomerase IIalpha rapidly relaxes positively supercoiled DNA: implications for enzyme action ahead of replication forks.
16139951 2006 Germline variations of the topoisomerase IIalpha gene as risk factors for primary gastric B-cell lymphoma.
16114891 2005 Impact of the C-terminal domain of topoisomerase IIalpha on the DNA cleavage activity of the human enzyme.
16100112 2005 Nucleotide-dependent domain movement in the ATPase domain of a human type IIA DNA topoisomerase.
16091284 2005 A biochemical analysis of topoisomerase II alpha and beta kinase activity found in HIV-1 infected cells and virus.
16053917 2005 Separation of bisdioxopiperazine- and vanadate resistance in topoisomerase II.
15965487 2005 BRCA1 participates in DNA decatenation.
15899781 2005 HER-2/neu and topoisomerase IIa gene amplification and protein expression in invasive breast carcinomas: chromogenic in situ hybridization and immunohistochemical analyses.
15809708 2005 DNA topoisomerase IIalpha and Her-2/neu gene dosages in pediatric malignant gliomas.
15635413 2005 Nucleolar proteome dynamics.
15602006 2005 Biochemical and proteomics approaches to characterize topoisomerase IIalpha cysteines and DNA as targets responsible for cisplatin-induced inhibition of topoisomerase IIalpha.
15504738 2005 Genes affecting the cell cycle, growth, maintenance, and drug sensitivity are preferentially regulated by anti-HER2 antibody through phosphatidylinositol 3-kinase-AKT signaling.
15491148 2004 DNA ligation catalyzed by human topoisomerase II alpha.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15456904 2004 Construction, characterization, and complementation of a conditional-lethal DNA topoisomerase IIalpha mutant human cell line.
15375522 2004 Prognostic value of Topoisomerase II in female breast cancer.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15201855 2004 Topoisomerase IIalpha as a prognostic factor in mantle cell lymphoma.
15182198 2004 1,4-Benzoquinone is a topoisomerase II poison.
15126503 2004 Interaction between glucose-regulated destruction domain of DNA topoisomerase IIalpha and MPN domain of Jab1/CSN5.
15044480 2004 Enhanced processing of UVA-irradiated DNA by human topoisomerase II in living cells.
15037624 2004 A mutation in human topoisomerase II alpha whose expression is lethal in DNA repair-deficient yeast cells.
14996935 2004 Functional compatibility between isoform alpha and beta of type II DNA topoisomerase.
14991576 2004 Coamplified and overexpressed genes at ERBB2 locus in gastric cancer.
14989736 2004 Unique cell membrane expression of topoisomerase-II alpha as a useful diagnostic marker of liposarcoma.
14978217 2004 Human topoisomerase IIalpha: targeting to subchromosomal sites of activity during interphase and mitosis.
14759373 2004 CTCF tethers an insulator to subnuclear sites, suggesting shared insulator mechanisms across species.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14632727 2003 Topoisomerase IIalpha gene (TOP2A) amplification and deletion in cancer--more common than anticipated.
14596941 2003 Kinetic analysis of human topoisomerase IIalpha and beta DNA binding by surface plasmon resonance.
14566826 2003 HER-2 and TOP2A coamplification in urinary bladder cancer.
12859955 2003 Induction of apoptosis by depletion of DNA topoisomerase IIalpha in mammalian cells.
12832072 2003 The SUMO pathway is required for selective degradation of DNA topoisomerase IIbeta induced by a catalytic inhibitor ICRF-193(1).
12821127 2003 Identification of functional nuclear export sequences in human topoisomerase IIalpha and beta.
12711669 2003 RNA helicase A interacts with dsDNA and topoisomerase IIalpha.
12691917 2003 DR1-like element in human topoisomerase IIalpha gene involved in enhancement of etoposide-induced apoptosis by PPARgamma ligand.
12646941 2003 Modification of topoisomerase genes copy number in newly diagnosed childhood acute lymphoblastic leukemia.
12646164 2003 Function of the loop residue Thr792 in human DNA topoisomerase II alpha.
12569090 2003 Phosphorylation of serine 1106 in the catalytic domain of topoisomerase II alpha regulates enzymatic activity and drug sensitivity.
12480934 2003 A human topoisomerase II alpha heterodimer with only one ATP binding site can go through successive catalytic cycles.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12429910 2002 Identification of promoter elements responsible for transcriptional inhibition of polo-like kinase 1 and topoisomerase IIalpha genes by p21(WAF1/CIP1/SDI1).
12429800 2002 Topoisomerase IIalpha expression in pituitary adenomas and carcinomas: relationship to tumor behavior.
12429798 2002 Circadian variation of topoisomerase II-alpha in human rectal crypt epithelium: implications for reduction of toxicity of chemotherapy.
12356743 2002 Co-localization of centromere activity, proteins and topoisomerase II within a subdomain of the major human X alpha-satellite array.
12237772 2002 DNA topoisomerase I and II expression in drug resistant germ cell tumours.
11958416 2002 Topoisomerase II alpha as a reliable proliferation marker in meningiomas.
11940573 2002 Interactions between protein kinase CK2 and Pin1. Evidence for phosphorylation-dependent interactions.
11940566 2002 The role of topoisomerase II in the excision of DNA loop domains during apoptosis.
11927602 2002 Dynamics of human DNA topoisomerases IIalpha and IIbeta in living cells.
11790298 2002 Directed proteomic analysis of the human nucleolus.
11574892 2001 DNA topoisomerase IIalpha is required for RNA polymerase II transcription on chromatin templates.
11136718 2001 Deacetylase activity associates with topoisomerase II and is necessary for etoposide-induced apoptosis.
11111056 2000 Two differentially spliced forms of topoisomerase IIalpha and beta mRNAs are conserved between birds and humans.
11101529 2000 Functional analysis of the human CDC5L complex and identification of its components by mass spectrometry.
11062478 2000 Histone deacetylase interacts directly with DNA topoisomerase II.
10959840 2000 DNA topoisomerase IIalpha interacts with CAD nuclease and is involved in chromatin condensation during apoptotic execution.
10942766 2000 Mitotic phosphorylation of DNA topoisomerase II alpha by protein kinase CK2 creates the MPM-2 phosphoepitope on Ser-1469.
10862613 2000 SUMO-1 conjugation to human DNA topoisomerase II isozymes.
10788521 2000 Modulation of human DNA topoisomerase IIalpha function by interaction with 14-3-3epsilon.
10666337 2000 Human topoisomerase IIalpha and IIbeta interact with the C-terminal region of p53.
10646863 2000 ICBP90, a novel human CCAAT binding protein, involved in the regulation of topoisomerase IIalpha expression.
10473615 1999 Using a biochemical approach to identify the primary dimerization regions in human DNA topoisomerase IIalpha.
10465010 1994 Expression of the 170-kDa and 180-kDa isoforms of DNA topoisomerase II in resting and proliferating human lymphocytes.
10393912 1999 Functional interaction between human topoisomerase IIalpha and retinoblastoma protein.
10095062 1999 Molecular cloning and characterization of the human topoisomerase IIalpha and IIbeta genes: evidence for isoform evolution through gene duplication.
9804834 1998 Casein kinase II catalyzes a mitotic phosphorylation on threonine 1342 of human DNA topoisomerase IIalpha, which is recognized by the 3F3/2 phosphoepitope antibody.
9795238 1998 Structural organization of the human TOP2A and TOP2B genes.
9049244 1997 Cell cycle-coupled relocation of types I and II topoisomerases and modulation of catalytic enzyme activities.
8939955 1996 Threonine 1342 in human topoisomerase IIalpha is phosphorylated throughout the cell cycle.
8710863 1996 Active heterodimers are formed from human DNA topoisomerase II alpha and II beta isoforms.
8393377 1993 Use of yeast in the study of anticancer drugs targeting DNA topoisomerases: expression of a functional recombinant human DNA topoisomerase II alpha in yeast.
8387155 1993 Modification of DNA topoisomerase II activity via direct interactions with the cyclic adenosine-3',5'-monophosphate response element-binding protein and related transcription factors.
8166723 1994 Molecular analysis of a potentially phorbol-regulatable region of the human topoisomerase II alpha gene promoter.
7980433 1994 Structure and function of type II DNA topoisomerases.
7961967 1994 Serine 1524 is a major site of phosphorylation on human topoisomerase II alpha protein in vivo and is a substrate for casein kinase II in vitro.
7635160 1995 Human topoisomerase II alpha is phosphorylated in a cell-cycle phase-dependent manner by a proline-directed kinase.
7585537 1995 Selective use of an alternative stop codon and polyadenylation signal within intron sequences leads to a truncated topoisomerase II alpha messenger RNA and protein in human HL-60 leukemia cells selected for resistance to mitoxantrone.
7499337 1995 Cell cycle phase-specific phosphorylation of human topoisomerase II alpha. Evidence of a role for protein kinase C.
6267071 1981 A homogeneous type II DNA topoisomerase from HeLa cell nuclei.
2845399 1988 Cloning and sequencing of cDNA encoding human DNA topoisomerase II and localization of the gene to chromosome region 17q21-22.
2836804 1988 Reduced DNA topoisomerase II activity in ataxia-telangiectasia cells.
2556712 1989 Characterization and immunological identification of cDNA clones encoding two human DNA topoisomerase II isozymes.
1652758 1991 Expression of a mutant DNA topoisomerase II in CCRF-CEM human leukemic cells selected for resistance to teniposide.
1651812 1991 Identification of a point mutation in the topoisomerase II gene from a human leukemia cell line containing an amsacrine-resistant form of topoisomerase II.
1373318 1992 Amplification of the topoisomerase II alpha gene in a non-small cell lung cancer cell line and characterisation of polymorphisms at the human topoisomerase II alpha and beta loci in normal tissue.
1309226 1992 Topoisomerase II alpha and topoisomerase II beta genes: characterization and mapping to human chromosomes 17 and 3, respectively.