Property Summary

NCBI Gene PubMed Count 28
PubMed Score 56.66
PubTator Score 8.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Multiple myeloma 1.099 1.9e-03
ependymoma -1.200 4.3e-02
osteosarcoma 1.445 2.1e-03
sonic hedgehog group medulloblastoma 1.400 8.7e-04
atypical teratoid / rhabdoid tumor 1.100 3.9e-05
glioblastoma 1.100 1.7e-04
medulloblastoma, large-cell 2.200 1.7e-04
non-small cell lung cancer 1.131 3.3e-17
lung cancer 1.200 4.2e-04

Gene RIF (17)

PMID Text
25609812 Collectively, this study characterizes a novel protein complex, Tom70/Hsp90/IRF3/Bax, that is important for Sendai virus-induced apoptosis.
25022898 Tom70 acts as a molecular switch that orchestrates hypertrophic stresses and mitochondrial responses to determine pathological cardiac hypertrophy.
24149440 Blockade of mitochondrial protein import triggers the recruitment of PARK2, by PINK1, to the TOMM machinery.
23472196 PINK1 is imported into mitochondria by a unique pathway that is independent of the TOM core complex but crucially depends on the import receptor Tom70
22032846 The hepatitis C virus NS3/4A protein induced Tom70 expression.
21781956 used biophysical tools to study the interaction between the C-terminal domain of Hsp90 (C-Hsp90), which contains the EEVD motif that binds to TPR domains, and the cytosolic fragment of Tom70
21771790 a novel model in which Tom20 binds Tom70 to facilitate preprotein release from the chaperones by competition
21412788 This study revealed a novel finding, that is, human TOM70 is linked with the hepatitis C virus NS3 protein and the apoptotic response.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20628368 Tom70 as a critical adaptor linking MAVS to TBK1/IRF3, revealing that mitochondrion is evolutionarily integrated with innate immunity.
20504278 results indicate that the Tom70 monomers are the functional form of the receptor, whereas the homodimers appear to be a minor population, and may represent an inactive state
18852034 nuclear respiratory factor-2 binding site methylation suppresses the promoter activity of the human TOMM70 gene
18669640 S100A2 and S100A6 interact with another TPR protein Tom70 and regulate the Tom70-ligand interaction in vitro
18187620 Knockdown of translocase of outer mitochondrial membrane 70 homolog A (TOMM70A) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
16968702 suggests a novel active role for Hsp90 in import steps subsequent to Tom70 targeting.
16822835 The internal EELD domain facilitates mitochondrial targeting of Mcl-1 via a Tom70-dependent pathway.
12200962 TOMM70A is ubiquitously expressed in human tissues, maps on chromosome 3q13.1-q13.2 and consists of 12 coding exons spanning over 37 kb.

AA Sequence

MAASKPVEAAVVAAAVPSSGSGVGGGGTAGPGTGGLPRWQLALAVGAPLLLGAGAIYLWSRQQRRREARG      1 - 70
RGDASGLKRNSERKTPEGRASPAPGSGHPEGPGAHLDMNSLDRAQAAKNKGNKYFKAGKYEQAIQCYTEA     71 - 140
ISLCPTEKNVDLSTFYQNRAAAFEQLQKWKEVAQDCTKAVELNPKYVKALFRRAKAHEKLDNKKECLEDV    141 - 210
TAVCILEGFQNQQSMLLADKVLKLLGKEKAKEKYKNREPLMPSPQFIKSYFSSFTDDIISQPMLKGEKSD    211 - 280
EDKDKEGEALEVKENSGYLKAKQYMEEENYDKIISECSKEIDAEGKYMAEALLLRATFYLLIGNANAAKP    281 - 350
DLDKVISLKEANVKLRANALIKRGSMYMQQQQPLLSTQDFNMAADIDPQNADVYHHRGQLKILLDQVEEA    351 - 420
VADFDECIRLRPESALAQAQKCFALYRQAYTGNNSSQIQAAMKGFEEVIKKFPRCAEGYALYAQALTDQQ    421 - 490
QFGKADEMYDKCIDLEPDNATTYVHKGLLQLQWKQDLDRGLELISKAIEIDNKCDFAYETMGTIEVQRGN    491 - 560
MEKAIDMFNKAINLAKSEMEMAHLYSLCDAAHAQTEVAKKYGLKPPTL                          561 - 608
//

Text Mined References (43)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25609812 2015 Tom70 mediates Sendai virus-induced apoptosis on mitochondria.
25022898 2014 Tom70 serves as a molecular switch to determine pathological cardiac hypertrophy.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24149440 2013 The TOMM machinery is a molecular switch in PINK1 and PARK2/PARKIN-dependent mitochondrial clearance.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23911537 2013 Cytoplasmic ribosomal protein S3 (rpS3) plays a pivotal role in mitochondrial DNA damage surveillance.
23472196 2013 Tom70 is essential for PINK1 import into mitochondria.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22032846 2012 Translocase of outer mitochondrial membrane 70 induces interferon response and is impaired by hepatitis C virus NS3.
21781956 2011 Stoichiometry and thermodynamics of the interaction between the C-terminus of human 90kDa heat shock protein Hsp90 and the mitochondrial translocase of outer membrane Tom70.
21771790 2011 Interaction between the human mitochondrial import receptors Tom20 and Tom70 in vitro suggests a chaperone displacement mechanism.
21412788 2011 Translocase of outer mitochondrial membrane 70 expression is induced by hepatitis C virus and is related to the apoptotic response.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20628368 2010 Tom70 mediates activation of interferon regulatory factor 3 on mitochondria.
20531390 2010 Suppression of the novel ER protein Maxer by mutant ataxin-1 in Bergman glia contributes to non-cell-autonomous toxicity.
20504278 2010 Human mitochondrial import receptor Tom70 functions as a monomer.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18852034 2008 In vitro methylation of nuclear respiratory factor-2 binding sites suppresses the promoter activity of the human TOMM70 gene.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18669640 2008 Interactions of S100A2 and S100A6 with the tetratricopeptide repeat proteins, Hsp90/Hsp70-organizing protein and kinesin light chain.
18570454 2008 Proteomic analysis of exosomes from human neural stem cells by flow field-flow fractionation and nanoflow liquid chromatography-tandem mass spectrometry.
18331822 2008 Identification of Tom5 and Tom6 in the preprotein translocase complex of human mitochondrial outer membrane.
18088087 2008 Phosphoproteome of resting human platelets.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16968702 2006 Hsp90 functions in the targeting and outer membrane translocation steps of Tom70-mediated mitochondrial import.
16822835 2006 An internal EELD domain facilitates mitochondrial targeting of Mcl-1 via a Tom70-dependent pathway.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15644312 2005 Dissection of the mitochondrial import and assembly pathway for human Tom40.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12526792 2003 Molecular chaperones Hsp90 and Hsp70 deliver preproteins to the mitochondrial import receptor Tom70.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12200962 Characterization of a human import component of the mitochondrial outer membrane, TOMM70A.
10582581 1999 Identification of a mammalian homologue of the fungal Tom70 mitochondrial precursor protein import receptor as a thyroid hormone-regulated gene in specific brain regions.
9872452 1998 Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.