Property Summary

NCBI Gene PubMed Count 6
PubMed Score 8.55
PubTator Score 4.20

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Gene RIF (1)

AA Sequence

MFRIEGLAPKLDPEEMKRKMREDVISSIRNFLIYVALLRVTPFILKKLDSI                         1 - 51
//

Text Mined References (9)

PMID Year Title