Property Summary

NCBI Gene PubMed Count 23
PubMed Score 45.87
PubTator Score 28.68

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma 1.302 9.7e-04
atypical teratoid / rhabdoid tumor -1.100 1.1e-02
diabetes mellitus -1.100 1.1e-03
Breast cancer 3.600 3.1e-02
group 3 medulloblastoma 1.400 3.5e-02
non primary Sjogren syndrome sicca 1.100 1.5e-02
pituitary cancer 1.100 1.0e-05

Gene RIF (10)

PMID Text
26787839 Tom22 is essential for metabolic conversion, as its knockdown by small interfering RNA (siRNA) completely ablated progesterone conversion in both steroidogenic mouse Leydig MA-10 and human adrenal NCI cells.
24886575 HIV-1 PR interacts with mitochondrial proteins VDAC, cytochrome c, TOM22, and Bax in HeLa cells
24149440 Blockade of mitochondrial protein import triggers the recruitment of PARK2, by PINK1, to the TOMM machinery.
23874603 HIV-1 PR interacts with mitochondrial proteins VDAC, cytochrome c, TOM22, and Bax in HeLa cells
22198199 The interaction with the cytosolic domain of Tom22 helps Bax to acquire a conformation able to interact with the outer mitochondrial membrane.
22178394 Studies indicate that PUMA and TOMM22 as potential targets for miRNA-BART viral transcripts.
20877624 Observational study of gene-disease association. (HuGE Navigator)
17096026 We have identified TOM22, a component of the translocase of the outer mitochondrial membrane (TOM), as a mitochondrial receptor of Bax.
14699115 the cytosolic domains of Tom20 and Tom22 function to maintain their substrate preproteins unfolded and prevent them from aggregating on the mitochondrial surface
12198123 Levels of Tom22 in mitochondria accelerate the rate of Tom7 assembly into the mature TOM complex.

AA Sequence

MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLS      1 - 70
LFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQILLGPNTGLSGGMPGALPSLPG     71 - 140
KI                                                                        141 - 142
//

Text Mined References (32)

PMID Year Title
26787839 2016 An Outer Mitochondrial Translocase, Tom22, Is Crucial for Inner Mitochondrial Steroidogenic Regulation in Adrenal and Gonadal Tissues.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25556234 2015 New host factors important for respiratory syncytial virus (RSV) replication revealed by a novel microfluidics screen for interactors of matrix (M) protein.
24149440 2013 The TOMM machinery is a molecular switch in PINK1 and PARK2/PARKIN-dependent mitochondrial clearance.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22198199 2012 The cytosolic domain of human Tom22 modulates human Bax mitochondrial translocation and conformation in yeast.
22178394 2012 The role of miRNAs and EBV BARTs in NPC.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18331822 2008 Identification of Tom5 and Tom6 in the preprotein translocase complex of human mitochondrial outer membrane.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17096026 2007 TOM22, a core component of the mitochondria outer membrane protein translocation pore, is a mitochondrial receptor for the proapoptotic protein Bax.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
15644312 2005 Dissection of the mitochondrial import and assembly pathway for human Tom40.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14699115 2004 Mitochondrial import receptors Tom20 and Tom22 have chaperone-like activity.
14557246 2003 AIP is a mitochondrial import mediator that binds to both import receptor Tom20 and preproteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12198123 2002 Insertion and assembly of human tom7 into the preprotein translocase complex of the outer mitochondrial membrane.
10982837 2000 Identification and functional analysis of human Tom22 for protein import into mitochondria.
10980201 2000 Characterization of rat TOM40, a central component of the preprotein translocase of the mitochondrial outer membrane.
10900208 2000 Identification of mammalian TOM22 as a subunit of the preprotein translocase of the mitochondrial outer membrane.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.