Property Summary

NCBI Gene PubMed Count 24
PubMed Score 56.71
PubTator Score 121.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Gene RIF (12)

PMID Text
25536093 the quantity of PRM1, PRM2, and TNP2 transcripts and the PRM1/PRM2 mRNA ratio affect spermiogenesis, sperm morphology
23327642 MiR-122 may influence spermatozoa-like cells by suppressing TNP2 expression and inhibiting the expression of proteins associated with sperm development.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20522125 analysis of the TNP2 gene did not show any association with infertility.
20522125 Observational study of gene-disease association. (HuGE Navigator)
20378615 Observational study of gene-disease association. (HuGE Navigator)
19710011 Acetylation of transition protein 2 (TP2) by KAT3B (p300) alters its DNA condensation property and interaction with putative histone chaperone NPM3.
19460752 Knockdown of transition protein 2 (during histone to protamine replacement) (TNP2) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
18727729 The presence of transition proteins (TP1 and/or TP2) in spermatids in semen indicates inhibition in the differentiation pathway from round spermatids to spermatozoa in infertile men.
17852044 We found significantly lower levels of HILS1, TNP1, and TNP2 transcripts in spermatozoa from asthenozoospermic men compared to normozoospermic men.
16989827 Observational study of gene-disease association. (HuGE Navigator)
16291974 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MDTQTHSLPITHTQLHSNSQPQSRTCTRHCQTFSQSCRQSHRGSRSQSSSQSPASHRNPTGAHSSSGHQS      1 - 70
QSPNTSPPPKRHKKTMNSHHSPMRPTILHCRCPKNRKNLEGKLKKKKMAKRIQQVYKTKTRSSGWKSN       71 - 138
//

Text Mined References (24)

PMID Year Title
25536093 2015 Quantification of sperm specific mRNA transcripts (PRM1, PRM2, and TNP2) in teratozoospermia and normozoospermia: New correlations between mRNA content and morphology of sperm.
23568457 2013 Genetic variants associated with disordered eating.
23327642 2013 MicroRNA-122 influences the development of sperm abnormalities from human induced pluripotent stem cells by regulating TNP2 expression.
22190364 2011 Genome-wide meta-analysis identifies novel multiple sclerosis susceptibility loci.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20522125 2011 The TNP1 haplotype - GCG is associated with azoospermia.
20378615 2010 Evaluation of 172 candidate polymorphisms for association with oligozoospermia or azoospermia in a large cohort of men of European descent.
19710011 2009 Acetylation of transition protein 2 (TP2) by KAT3B (p300) alters its DNA condensation property and interaction with putative histone chaperone NPM3.
18978792 2008 Meta-analysis of genome-wide association study data identifies additional type 1 diabetes risk loci.
18727729 2008 Spermiogenesis defects in human: detection of transition proteins in semen from some infertile men.
17852044 Quantitative assessment of transition proteins 1, 2 spermatid-specific linker histone H1-like protein transcripts in spermatozoa from normozoospermic and asthenozoospermic men.
16989827 2006 Identification of novel polymorphisms in the nuclear protein genes and their relationship with human sperm protamine deficiency and severe male infertility.
16291974 Single-nucleotide polymorphisms and mutation analyses of the TNP1 and TNP2 genes of fertile and infertile human male populations.
12775710 2003 The structural organization of sperm chromatin.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10659848 2000 Rapid evolution of male reproductive genes in the descent of man.
9809674 1998 Expression of mRNA and protein of nucleoproteins during human spermiogenesis.
8961924 1996 Zinc dependent recognition of a human CpG island sequence by the mammalian spermatidal protein TP2.
8428967 1993 Linkage of human spermatid-specific basic nuclear protein genes. Definition and evolution of the P1-->P2-->TP2 locus.
7983046 1994 Characterization of a human locus in transition.
7711033 1995 DNA condensation by the rat spermatidal protein TP2 shows GC-rich sequence preference and is zinc dependent.
2250010 1990 Interaction of spermatid-specific protein TP2 with nucleic acids, in vitro. A comparative study with TP1.
1395729 1992 The genes for protamine 1 and 2 (PRM1 and PRM2) and transition protein 2 (TNP2) are closely linked in the mammalian genome.
1385303 1992 The gene for human transition protein 2: nucleotide sequence, assignment to the protamine gene cluster, and evidence for its low expression.