Property Summary

Ligand Count 200
NCBI Gene PubMed Count 43
PubMed Score 85.96
PubTator Score 407.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.100 1.7e-03
atypical teratoid / rhabdoid tumor 2.000 4.3e-04
group 4 medulloblastoma 1.600 7.5e-03
interstitial lung disease -1.100 4.2e-02
medulloblastoma, large-cell -1.400 2.5e-03
osteosarcoma 1.954 1.0e-04
ovarian cancer -1.100 2.1e-04
pancreatic cancer -1.400 2.0e-02
pancreatic carcinoma -1.400 2.0e-02

 IMPC Phenotype (1)

Protein-protein Interaction (3)

PDB (141)

Gene RIF (24)

AA Sequence

MSGRRCAGGGAACASAAAEAVEPAARELFEACRNGDVERVKRLVTPEKVNSRDTAGRKSTPLHFAAGFGR      1 - 70
KDVVEYLLQNGANVQARDDGGLIPLHNACSFGHAEVVNLLLRHGADPNARDNWNYTPLHEAAIKGKIDVC     71 - 140
IVLLQHGAEPTIRNTDGRTALDLADPSAKAVLTGEYKKDELLESARSGNEEKMMALLTPLNVNCHASDGR    141 - 210
KSTPLHLAAGYNRVKIVQLLLQHGADVHAKDKGDLVPLHNACSYGHYEVTELLVKHGACVNAMDLWQFTP    211 - 280
LHEAASKNRVEVCSLLLSYGADPTLLNCHNKSAIDLAPTPQLKERLAYEFKGHSLLQAAREADVTRIKKH    281 - 350
LSLEMVNFKHPQTHETALHCAAASPYPKRKQICELLLRKGANINEKTKEFLTPLHVASEKAHNDVVEVVV    351 - 420
KHEAKVNALDNLGQTSLHRAAYCGHLQTCRLLLSYGCDPNIISLQGFTALQMGNENVQQLLQEGISLGNS    421 - 490
EADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGL    491 - 560
VPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEICKLLLQHGADPTKKNRDGNTPLD    561 - 630
LVKDGDTDIQDLLRGDAALLDAAKKGCLARVKKLSSPDNVNCRDTQGRHSTPLHLAAGYNNLEVAEYLLQ    631 - 700
HGADVNAQDKGGLIPLHNAASYGHVDVAALLIKYNACVNATDKWAFTPLHEAAQKGRTQLCALLLAHGAD    701 - 770
PTLKNQEGQTPLDLVSADDVSALLTAAMPPSALPSCYKPQVLNGVRSPGATADALSSGPSSPSSLSAASS    771 - 840
LDNLSGSFSELSSVVSSSGTEGASSLEKKEVPGVDFSITQFVRNLGLEHLMDIFEREQITLDVLVEMGHK    841 - 910
ELKEIGINAYGHRHKLIKGVERLISGQQGLNPYLTLNTSGSGTILIDLSPDDKEFQSVEEEMQSTVREHR    911 - 980
DGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAY    981 - 1050
IGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMKMAHSPP   1051 - 1120
GHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPEGMVDG                           1121 - 1166
//

Text Mined References (46)

PMID Year Title