Property Summary

NCBI Gene PubMed Count 17
PubMed Score 46.67
PubTator Score 161.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
psoriasis 6514 8.0e-16
ulcerative colitis 1765 1.1e-08
malignant mesothelioma 3135 3.0e-06
tuberculosis 1963 1.8e-05
lung carcinoma 2755 6.9e-04
lung cancer 4607 3.8e-03
active Crohn's disease 882 1.1e-02
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.8
Kidney cancer 2548 0.0 0.5
Disease Target Count Z-score Confidence
Breast cancer 3469 0.0 2.2
Disease Target Count Z-score Confidence
Lysinuric protein intolerance 15 3.266 1.6

Expression

  Differential Expression (7)

Disease log2 FC p
active Crohn's disease 3.313 1.1e-02
lung cancer -1.800 3.8e-03
lung carcinoma -1.600 6.9e-04
malignant mesothelioma -2.400 3.0e-06
psoriasis 1.200 8.0e-16
tuberculosis -2.400 1.8e-05
ulcerative colitis 5.100 1.1e-08

Gene RIF (11)

AA Sequence

MAHFVQGTSRMIAAESSTEHKECAEPSTRKNLMNSLEQKIRCLEKQRKELLEVNQQWDQQFRSMKELYER      1 - 70
KVAELKTKLDAAERFLSTREKDPHQRQRKDDRQREDDRQRDLTRDRLQREEKEKERLNEELHELKEENKL     71 - 140
LKGKNTLANKEKEHYECEIKRLNKALQDALNIKCSFSEDCLRKSRVEFCHEEMRTEMEVLKQQVQIYEED    141 - 210
FKKERSDRERLNQEKEELQQINETSQSQLNRLNSQIKACQMEKEKLEKQLKQMYCPPCNCGLVFHLQDPW    211 - 280
VPTGPGAVQKQREHPPDYQWYALDQLPPDVQHKANGLSSVKKVHP                             281 - 325
//

Text Mined References (19)

PMID Year Title