Property Summary

NCBI Gene PubMed Count 85
PubMed Score 64.51
PubTator Score 201.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Rheumatoid Arthritis 1.400 7.9e-03
osteosarcoma -2.679 1.1e-05
astrocytoma 1.200 9.5e-03
medulloblastoma, large-cell 1.100 8.9e-04
tuberculosis -1.400 1.3e-07
lung cancer -1.200 1.8e-02
breast carcinoma -1.100 2.8e-04
fibroadenoma -1.100 3.4e-02
spina bifida -1.422 3.6e-02
ductal carcinoma in situ -1.100 7.0e-04
invasive ductal carcinoma -1.400 2.9e-03
ovarian cancer 2.000 2.0e-06

Protein-protein Interaction (3)

Gene RIF (61)

PMID Text
26738398 Data suggest that tumour necrosis factor alpha-induced protein 3 (TNFAIP3) and TNFAIP3-interacting protein 1 (TNIP1) single nucleotide polymorphisms (SNPs) confer increased risk of psoriasis in ethnic South Indian Tamils.
26733199 HIV-1 depends on host-cell-encoded factors to complete its life cycle; data suggest that nucleus-located NAF1/TNIP1 promotes nuclear export of un-spliced HIV-1 gag mRNA; association between NAF1/TNIP1 and CRM1 is required for this function.
26382585 Hepatitis C virus antigen stimulation up-regulates A20/A20-binding inhibitor of NF-kappaB binding protein expression, which consequently contributes to inefficient M1 macrophage polarization.
25631139 Since TNIP1 may facilitate the function of TNFAIP3 in the negative feedback regulation of NF-kappaB activation [5], the corresponding transcript levels of TNIP1 in psoriasis vul- garis were investigated in this study.
25447897 HSPA6 regulation by TNIP1 occurs in promoter regions lacking binding sites for known TNIP1-repressed transcription factors
25264125 The aim of this study was to investigate whether the HCP5, TNIP1, TNFAIP3, SPATA2 and COG6 genes were genetic risk factors for psoriasis in Chinese population.
25034154 Single-nucleotide polymorphisms rs7708392 and rs495881 in TNIP1 were significantly associated with Lupus Nephritis in individuals with European or African ancestry.
24788730 TNIP1 polymorphism may be a risk factor for VKH syndrome in Han Chinese
24091983 Report role of TNIP1 genetic variants in confering risk of systemic lupus erythematosus in Chinese population.
23970121 variants in the TNIP1 gene are associated with the risk for lupus nephritis and could be mechanistically involved in disease development via aberrant regulation of NF-kappaB and mitogen-activated protein kinase activity.
23944604 We conclude that polymorphisms in TNIP1 are associated with antibody-positive primary Sjogren's syndrome.
23911423 Data indicate significant multiplicative interaction observed between NFKB1 rs28362491 and TNIP1 rs3792783 in systemic lupus erythematosus.
23858047 Analysis of SNP in the TNIP1 gene and expression of this gene in peripheral blood lymphocytes indicated these SNP were associated with the occurrence of systemic lupus erythematosus in Han Chinese patients.
23541940 TNIP1/ANXA6 and CSMD1 variants interacting with cigarette smoking and alcohol intake affect risk of psoriasis.
23464785 Analysis of the TNIP1 promoter reveals multiple transcription start sites in its GC-rich proximal regions along with two transcriptionally active specificity protein (SP) sites, responsive to both Sp1 and Sp3.
23055271 This study demonistrated that (151) Pro-->Ala change in TNIP1 association to myasthenia gravis.
22896740 These data confirmed the influence of TNIP1 on an increased susceptibility to systemic sclerosis and reinforced this locus as a common autoimmunity risk factor.
22833143 Our results confirm the association signals between systemic lupus erythematosus and TNIP1 variants in multiple populations and provide new insight into the mechanism by which TNIP1 variants may contribute to SLE pathogenesis.
22542476 we integrate the current knowledge of TNIP1s functions with the diseases in which it has been associated to potentially elucidate the role this regulator has in promoting or alleviating these inflammatory diseases[review]
22147607 The varying levels and distribution of TNIP1 in normal and disease state tissues could be expected to affect processes in which TNIP1 is involved
22093807 recombinant transgene facilitates the transcription of pro-inflammatory cytokines in fibroblast-like synoviocytes in rheumatoid arthritis
22087647 Data indicate that TNFAIP3, ETS1 and TNIP1 are probably common susceptibility genes for systemic lupus erythematosus (SLE) in Chinese populations, and they may contribute to the pathogenesis of multiple SLE subphenotypes.
22001530 The TNIP1 distal promoter, approximately 4600 nucleotides upstream of a frequently utilized transcription start site region, contains PPAR-gamma and NF-kappaB sites that bind the respective transcription factors in vivo.
21967852 The requirements for TNIP1-peroxisome proliferator activated receptor (PPAR) interaction are characteristic for coactivators; however, TNIP1 partially decreases PPAR activity.
21885437 ABIN1 requires its ubiquitin binding domain and cooperates with TAX1BP1 and A20 to restrict antiviral signaling.
21750679 A markedly reduced expression of the TNIP1 gene and also its protein product were observed both in lesional skin tissue and in cultured dermal fibroblasts from SSc(Systemic sclerosis) patients.
21674837 The researchers found a genotype association of SNP rs1808593 NOS3 polymorphisms and HIE.
21623003 The IL23A and TNIP1 genes showed convincing evidence for association SNPs mapping to previously reported psoriasis loci show evidence for association to PSA.
21606507 the interaction of ABIN1 with polyubiquitin is required to limit the activation of TLR-MyD88 pathways and prevent autoimmunity
21266526 A20, ABIN-1/2, and CARD11 mutations have prognostic value in gastrointestinal diffuse large B-cell lymphoma
21068098 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20849588 Association of TNIP1 with systemic lupus erythematosus was confirmed in a Japanese population
20849588 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20516000 Significant associations were found for the single nucleotide polymorphism rs10036748 of TNIP1 with photosensitivity and vasculitis in patients with systemic lupus erythematosus
20516000 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19838195 identified five new systemic lupus erythematosus susceptibility loci (P < 5 x 10(-8)): TNIP1 (odds ratio (OR) = 1.27), PRDM1 (OR = 1.20), JAZF1 (OR = 1.20), UHRF1BP1 (OR = 1.17) and IL10 (OR = 1.19).
19838195 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19838193 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19773279 Observational study of gene-disease association. (HuGE Navigator)
19732752 TNIP1 interacts with liganded RARalpha and RARgamma but acts as a corepressor of their activity.
19695220 the effects of ABIN-1 on p105 processing and of p105 on stabilizing ABIN-1 act to potentiate the NF-kappaB inhibitory activity of ABIN-1.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19464428 This review defines ABIN-1 based on three different parameters: ability to bind A20; ability to inhibit NF-kappaB activation upon overexpression; the presence of specific short amino acid regions of strong homology, designated ABIN homology domains.
19277210 The shRNA barcode screening technique identified TNIP1 as being involved in p53 regulation.
19262574 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19169254 Expanded catalog of genetic loci implicated in psoriasis susceptibility.
18676680 Observational study of gene-disease association. (HuGE Navigator)
18622428 role for an ABIN-sensitive non-classical NF-kappaB signalling pathway in the proliferation of EGFR-overexpressing tumour cells.
18212736 an important role for ubiquitin binding in the negative regulation of NF-kappaB signaling by ABINs and identify UBAN as a novel UBD.
17135485 NAF1 associates with mature H/ACA RNA
17016622 Novel splice variants of the Naf1 gene were identified.
16684768 ABIN-1 physically links A20 to NEMO/IKKgamma and facilitates A20-mediated de-ubiquitination of NEMO/IKKgamma, thus resulting in inhibition of NF-kappaB
16601202 NAF1 is required for accumulation of human box H/ACA, snoRNPs, scaRNPs, and telomerase.
14526201 alternative splicing and role implicated in interaction with HIV-1
12965196 TNF-alpha induces Naf1 gene expression in synoviocytes.
12220502 A new ERK2 binding protein, Naf1, attenuates the EGF/ERK2 nuclear signaling.
11090181 Nef-associated factor 1 (Naf1) binds to HIV-1 Nef through amino acids 94-412 of Naf1; overexpression of Naf1 in 293T cells increases CD4 expression, and Nef suppresses this activity of Naf1 to downregulate CD4
9923610 Nef-associated factor 1 (Naf1) binds to HIV-1 Nef through amino acids 94-412 of Naf1; overexpression of Naf1 in 293T cells increases CD4 expression, and Nef suppresses this activity of Naf1 to downregulate CD4

AA Sequence

MEGRGPYRIYDPGGSVPSGEASAAFERLVKENSRLKEKMQGIKMLGELLEESQMEATRLRQKAEELVKDN      1 - 70
ELLPPPSPSLGSFDPLAELTGKDSNVTASPTAPACPSDKPAPVQKPPSSGTSSEFEVVTPEEQNSPESSS     71 - 140
HANAMALGPLPREDGNLMLHLQRLETTLSVCAEEPDHGQLFTHLGRMALEFNRLASKVHKNEQRTSILQT    141 - 210
LCEQLRKENEALKAKLDKGLEQRDQAAERLREENLELKKLLMSNGNKEGASGRPGSPKMEGTGKKAVAGQ    211 - 280
QQASVTAGKVPEVVALGAAEKKVKMLEQQRSELLEVNKQWDQHFRSMKQQYEQKITELRQKLADLQKQVT    281 - 350
DLEAEREQKQRDFDRKLLLAKSKIEMEETDKEQLTAEAKELRQKVKYLQDQLSPLTRQREYQEKEIQRLN    351 - 420
KALEEALSIQTPPSSPPTAFGSPEGAGALLRKQELVTQNELLKQQVKIFEEDFQRERSDRERMNEEKEEL    421 - 490
KKQVEKLQAQVTLSNAQLKAFKDEEKAREALRQQKRKAKASGERYHVEPHPEHLCGAYPYAYPPMPAMVP    491 - 560
HHGFEDWSQIRYPPPPMAMEHPPPLPNSRLFHLPEYTWRLPCGGVRNPNQSSQVMDPPTARPTEPESPKN    561 - 630
DREGPQ                                                                    631 - 636
//

Text Mined References (95)

PMID Year Title
26738398 2015 TNFAIP3 and TNIP1 polymorphisms confer psoriasis risk in South Indian Tamils.
26733199 2016 HIV-1 Nef-associated Factor 1 Enhances Viral Production by Interacting with CRM1 to Promote Nuclear Export of Unspliced HIV-1 gag mRNA.
26382585 2015 Up-regulation of A20/ABIN1 contributes to inefficient M1 macrophage polarization during Hepatitis C virus infection.
25631139 2015 Upregulation of tumor necrosis factor alpha-induced protein 3 interacting protein 1 mRNA in psoriasis vulgaris.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25447897 2015 TNIP1 reduction of HSPA6 gene expression occurs in promoter regions lacking binding sites for known TNIP1-repressed transcription factors.
25416956 2014 A proteome-scale map of the human interactome network.
25264125 2014 Investigating the genetic association of HCP5, SPATA2, TNIP1, TNFAIP3 and COG6 with psoriasis in Chinese population.
25034154 2014 Clinical perspectives on lupus genetics: advances and opportunities.
24788730 2014 Association of a TNIP1 polymorphism with Vogt-Koyanagi-Harada syndrome but not with ocular Behcet's disease in Han Chinese.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24091983 2014 Variants in TNFSF4, TNFAIP3, TNIP1, BLK, SLC15A4 and UBE2L3 interact to confer risk of systemic lupus erythematosus in Chinese population.
23970121 2013 ABIN1 dysfunction as a genetic basis for lupus nephritis.
23944604 2013 Association of genes in the NF-?B pathway with antibody-positive primary Sjögren's syndrome.
23911423 2013 Genetic interaction between genes involved in NF-?B signaling pathway in systemic lupus erythematosus.
23858047 2013 Single-nucleotide polymorphism and haplotypes of TNIP1 associated with systemic lupus erythematosus in a Chinese Han population.
23740937 2013 A systemic sclerosis and systemic lupus erythematosus pan-meta-GWAS reveals new shared susceptibility loci.
23541940 2013 TNIP1/ANXA6 and CSMD1 variants interacting with cigarette smoking, alcohol intake affect risk of psoriasis.
23464785 2013 Sp sites contribute to basal and inducible expression of the human TNIP1 (TNF?-inducible protein 3-interacting protein 1) promoter.
23414517 2013 A human skeletal muscle interactome centered on proteins involved in muscular dystrophies: LGMD interactome.
23273568 2013 Meta-analysis followed by replication identifies loci in or near CDKN1B, TET3, CD80, DRAM1, and ARID5B as associated with systemic lupus erythematosus in Asians.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23055271 2012 Risk for myasthenia gravis maps to a (151) Pro?Ala change in TNIP1 and to human leukocyte antigen-B*08.
22896740 2013 Confirmation of TNIP1 but not RHOB and PSORS1C1 as systemic sclerosis risk factors in a large independent replication study.
22833143 2012 Association of two independent functional risk haplotypes in TNIP1 with systemic lupus erythematosus.
22542476 2012 Emerging roles for TNIP1 in regulating post-receptor signaling.
22147607 2011 TNIP1, a retinoic acid receptor corepressor and A20-binding inhibitor of NF-?B, distributes to both nuclear and cytoplasmic locations.
22093807 2012 A pro-inflammatory role for A20 and ABIN family proteins in human fibroblast-like synoviocytes in rheumatoid arthritis.
22087647 2011 Replicated associations of TNFAIP3, TNIP1 and ETS1 with systemic lupus erythematosus in a southwestern Chinese population.
22001530 2012 PPAR? and NF-?B regulate the gene promoter activity of their shared repressor, TNIP1.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21967852 2011 TNIP1 is a corepressor of agonist-bound PPARs.
21885437 2011 ABIN1 protein cooperates with TAX1BP1 and A20 proteins to inhibit antiviral signaling.
21750679 2011 Genome-wide scan identifies TNIP1, PSORS1C1, and RHOB as novel risk loci for systemic sclerosis.
21674837 2011 Association of NOS3 tag polymorphisms with hypoxic-ischemic encephalopathy.
21623003 2011 Confirmation of TNIP1 and IL23A as susceptibility loci for psoriatic arthritis.
21606507 2011 Polyubiquitin binding to ABIN1 is required to prevent autoimmunity.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
21266526 2011 A20, ABIN-1/2, and CARD11 mutations and their prognostic value in gastrointestinal diffuse large B-cell lymphoma.
21068098 2011 Study of the common genetic background for rheumatoid arthritis and systemic lupus erythematosus.
20849588 2010 Association of TNFAIP3 interacting protein 1, TNIP1 with systemic lupus erythematosus in a Japanese population: a case-control association study.
20516000 2010 TNIP1, SLC15A4, ETS1, RasGRP3 and IKZF1 are associated with clinical features of systemic lupus erythematosus in a Chinese Han population.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20010814 2010 A bacterial E3 ubiquitin ligase IpaH9.8 targets NEMO/IKKgamma to dampen the host NF-kappaB-mediated inflammatory response.
19838195 2009 A large-scale replication study identifies TNIP1, PRDM1, JAZF1, UHRF1BP1 and IL10 as risk loci for systemic lupus erythematosus.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19732752 2009 Liganded RARalpha and RARgamma interact with but are repressed by TNIP1.
19695220 2009 ABIN-1 negatively regulates NF-kappaB by inhibiting processing of the p105 precursor.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19464428 2009 ABINs: A20 binding inhibitors of NF-kappa B and apoptosis signaling.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19262574 2009 Genome-wide association scan yields new insights into the immunopathogenesis of psoriasis.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19169254 2009 Genome-wide scan reveals association of psoriasis with IL-23 and NF-kappaB pathways.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18622428 2008 ABINs inhibit EGF receptor-mediated NF-kappaB activation and growth of EGF receptor-overexpressing tumour cells.
18212736 2008 Ubiquitin binding mediates the NF-kappaB inhibitory potential of ABIN proteins.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17632516 2007 P-selectin primes leukocyte integrin activation during inflammation.
17135485 2006 Dynamic association and localization of human H/ACA RNP proteins.
17016622 2006 Multiple splicing variants of Naf1/ABIN-1 transcripts and their alterations in hematopoietic tumors.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16684768 2006 ABIN-1 binds to NEMO/IKKgamma and co-operates with A20 in inhibiting NF-kappaB.
16601202 2006 hNaf1 is required for accumulation of human box H/ACA snoRNPs, scaRNPs, and telomerase.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15474016 2004 A20 is a potent inhibitor of TLR3- and Sendai virus-induced activation of NF-kappaB and ISRE and IFN-beta promoter.
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14743216 2004 A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14526201 2003 High frequency of alternative splicing of human genes participating in the HIV-1 life cycle: a model using TSG101, betaTrCP, PPIA, INI1, NAF1, and PML.
12965196 2003 Identification of Naf1/ABIN-1 among TNF-alpha-induced expressed genes in human synoviocytes using oligonucleotide microarrays.
12927788 2003 hLodestar/HuF2 interacts with CDC5L and is involved in pre-mRNA splicing.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12220502 2002 A new ERK2 binding protein, Naf1, attenuates the EGF/ERK2 nuclear signaling.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
11389905 2001 Functional redundancy of the zinc fingers of A20 for inhibition of NF-kappaB activation and protein-protein interactions.
11090181 2000 A human nuclear shuttling protein that interacts with human immunodeficiency virus type 1 matrix is packaged into virions.
10385526 1999 The zinc finger protein A20 inhibits TNF-induced NF-kappaB-dependent gene expression by interfering with an RIP- or TRAF2-mediated transactivation signal and directly binds to a novel NF-kappaB-inhibiting protein ABIN.
9923610 1999 Identification and cloning of a novel cellular protein Naf1, Nef-associated factor 1, that increases cell surface CD4 expression.
9687515 1998 Importin beta, transportin, RanBP5 and RanBP7 mediate nuclear import of ribosomal proteins in mammalian cells.
8681136 1996 Transcriptional map of the Treacher Collins candidate gene region.
7788527 1995 Prediction of the coding sequences of unidentified human genes. III. The coding sequences of 40 new genes (KIAA0081-KIAA0120) deduced by analysis of cDNA clones from human cell line KG-1.