Property Summary

NCBI Gene PubMed Count 117
PubMed Score 271.51
PubTator Score 183.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
hepatocellular carcinoma 1.100 5.2e-03
pancreatic cancer 1.300 6.0e-05
non-small cell lung cancer 1.020 2.5e-11
lung cancer -1.200 1.2e-03
pancreatic carcinoma 1.100 1.2e-02
Breast cancer 2.400 3.0e-03
invasive ductal carcinoma 2.079 1.1e-04
nasopharyngeal carcinoma 1.600 4.2e-04
lung carcinoma 1.200 1.2e-19
ovarian cancer 3.800 3.8e-05

Protein-protein Interaction (1)

Gene RIF (97)

PMID Text
27008001 Review/Meta-analysis: TNFSF4 (rs3850641) polymorphisms is not associated with coronary heart disease risk.
26348892 Given the discovery cohort, functional data, and importance of TNFSF4 in infection clearance, TNFSF4C may associate with outcomes and warrants future studies.
26125814 Study showed that the A allele of the rs7518045 and haplotype rs3861950C-rs17346501C-rs7518045A-rs1234313G in the TNFSF4 gene were associated with decreased risk for myocardial infarction in a Chinese Han population.
26070486 contributes to the aberrant T Follicular Helper response in systemic lupus erythematosus
25359291 Data indicate that soluble OX40 and sOX40L plasma levels are increased in early rheumatoid arthritis patients.
24595151 There were no significant associations between rs1234313, rs1234314 and rs17568 and atherosclerotic cerebral infarction risk in a Han Chinese population.
24583911 higher expression in patients with nasal polyposis compared with patients with chronic rhinosinusitis without nasal polyps
24091983 Report role of TNFSF4 genetic variants in confering risk of systemic lupus erythematosus in Chinese population.
23953582 Blocking of the interaction between OX40 and OX40L in vitro inhibited production of Thl and Th2 type cytokines in acute renal allograft rejection.
23948416 The expression levels of OX40 and OX40L were higher in pSS patients.
23936824 Our data firstly replicated the association of TNFSF4 with renal disorder in SLE patients in the Chinese population, which supported that TNFSF4 may act as a marker of lupus nephritis
23874208 Our data confirm a global signal at TNFSF4 and a role for the expressed product at multiple stages of lymphocyte dysregulation during SLE pathogenesis
23635951 Strong correlations have been observed between TNFSF4, TNFAIP3 and FAM167A-BLK polymorphisms with primary Sjogren's syndrome in Han Chinese.
23622253 TNFSF4 may have little significance as a common genetic component of Sjogren's syndrome and primary biliary cirrhosis in the Chinese Han population.
23589118 OX40L expression can be used as a marker to evaluate antiviral treatment efficacy and extend the notion that enhancement of OX40L expression could be a good way for immunotherapy in chronic hepatitis C patients.
23469620 The simultaneous expression of both OX40 and its ligand OX40L in idiopathic inflammatory myopathies suggests that they might participate in disease pathogenesis
23216302 results suggest that the rs3850641 and rs17568 polymorphisms in the OX40L and OX40 genes are associated with some of the lipid and lipoprotein variations in subjects with endogenous HTG
23184501 TNFSF4 gene polymorphism rs3861950, but not rs3850641, is associated with the risk of atherosclerosis CI in a Chinese population.
22870213 data primarily indicates that rs3850641 of OX40L gene contributes to sporadic breast carcinogenesis in a northeast Chinese Han population.
22850862 The results of a meta-analysis suggest that the TNFSF4 rs2205960 polymorphism may confer susceptibility to systemic lupus erythematosus (SLE) in different populations and that the TNFSF4 rs1234315 polymorphism is associated with susceptibility to SLE in Asians.
22847298 Changes in expression levels of TNFSF4 and TRAF2 mRNAs may significantly correlate with the pathogenesis of SLE, the disease activity and different clinical features of lupus, particularly lupus nephritis, atherosclerosis and arthritis
22820624 This meta-analysis confirms that TNFSF4 polymorphisms are associated with susceptibility to systemic lupus erythematosus in Asians and Europeans
22760717 Concentrations of sOX40L were found to be high in adult asthmatic patients and were associated with the severity of the disease. Therefore, sOX40L could be a potential infl ammatory mediator in the pathogenesis of asthma.
22646697 findings provide evidence for the involvement of OX40 and OX40L in the pathogenesis of AD though they are not specific to AD and in vitro results suggest complex interaction
22422496 We confirm TNFSF4 as an systemic sclerosis susceptibility gene and rs2205960 as a putative causal variant with preferential association in the ACA+ subphenotype.
22156349 Augmentation of OX40-OX40L signals in interferon type I receptor (IFNalphaR)-deficient transgenic mice can substantially enhance CD4+ T cell, but not CD8+ T cell primary responses.
21986129 High OX40L is associated with acute coronary syndrome and stable angina.
21820713 For the first time, we have shown that short ragweed pollen initiates TLR4-dependent TSLP/OX40L/OX40 signaling, which triggers T(H)2-dominant allergic inflammation
21781408 Up-regulation of OX40L may play a critical role in development of childhood atopic asthma and correlates with asthma severity.
21476935 OX40 gene polymorphism may be associated with a risk of ACS in the Han Chinese population, although the association between OX40L polymorphisms and ACS requires further investigation
21445270 data indicate that the TNFSF4 rs45454293T-allele is associated with lower TNFSF4 expression and increased risk of myocardial infarction
21402531 TNFSF4 is a susceptibility gene of coronary heart disease in Chinese Han population
21397857 Data show that MMP-2-conditioned dendritic cells primed naive CD4(+) T cells to differentiate into an inflammatory T(H)2 phenotype through OX40L expression and inhibition of IL-12p70 production.
21239696 These results demonstrate for the first time that HDAC11 plays an essential role in regulating OX40L expression.
21187296 The data confirm the influence of TNFSF4 polymorphisms in systemic sclerosis genetic susceptibility, especially in subsets of patients positive for lcSSc and anti-centromere antibodies.
21143648 Both OX40 upregulation and sOX40L increase were closely associated with Henoch-Schonlein purpura (HSP), especially HSP with nephritis.
21068098 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20962850 Observational study of gene-disease association. (HuGE Navigator)
20881011 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20861858 Observational study of gene-disease association. (HuGE Navigator)
20848568 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20844189 our data provide an in vivo role for the OX40/OX40L system in the innate immune response during polymicrobial sepsis
20677014 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20568250 Observational study of gene-disease association. (HuGE Navigator)
20331378 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20139223 OX40/OX40L expression is increased in the bronchial submucosa in mild asthma, but not in moderate-to-severe disease, and is related to the degree of tissue eosinophilia and IL-4 expression.
20012871 Our study not only suggested that the TNFSF4 gene was associated with systemic lupus erythematosus in the Chinese Han population, but also implied that the TNFSF4 gene might also predispose multiple populations to systemic lupus erythematosus.
20012871 Observational study of gene-disease association. (HuGE Navigator)
19951374 The results showed that microbial products up regulate the expression of M3 receptor in nasal mucosal immune cells that further increases the production of OX40L in nasal DCs and drives the production of TNF-alpha in nasal mucosa.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19838193 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19778912 Polymorphisms in the TNFSF4 gene region are associated with susceptibility to systemic sclerosis and its clinical and autoantibody subsets.
19778912 Observational study of gene-disease association. (HuGE Navigator)
19773279 Observational study of gene-disease association. (HuGE Navigator)
19663699 OX40L may play an important role in the early phase of T cell activation and proliferation
19578796 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19573080 Observational study of gene-disease association. (HuGE Navigator)
19494280 indicate a distinct CTL effector function in response to intracellular pathogens triggered via differing endogenous IL-2 production upon costimulation through CD252
19357697 Study confirmed the associations of BANK1 (rs3733197)and TNFSF4 (rs844648) with systemic lupus erythematosus in Hong Kong Chinese.
19357697 Observational study of gene-disease association. (HuGE Navigator)
19092840 This first replication study confirms the association of genetic variation in the upstream region of TNFSF4 with susceptibility to SLE.
19092840 Observational study of gene-disease association. (HuGE Navigator)
19083191 role in systemic lupus erythematosus (Review)
19029970 allele frequencies and genotype distributions of TNFSF4 SNPs were not substantially different between the control group and the myocardial infarction group.
19029446 Dendritic cells matured in the presence of PGE(2) induced the expression of OX40, OX40L, and CD70 on T cells facilitating T-cell/T-cell interaction that warrant long-lasting costimulation.
18998106 Study shows that TNFSF4 is expressed on antigen-presenting cells in human carotid atherosclerotic lesions but provides no evidence for an association of TNFSF4 gene variation with the risk for ischemic stroke.
18998106 Observational study of gene-disease association. (HuGE Navigator)
18987746 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18832690 thymic stromal lymphopoietin (TSLP) and human DCs plays an essential role in evoking inflammatory Th2 responses in allergy through OX40 ligand expression on DCs.
18718855 human primary T cells are programmed to rapidly express functional OX40L molecules after stimulation under DNA-damaging conditions, demonstrating that the induction of OX40L by T cells is independent of cell proliferation.
18674525 Patients with ACS show increased OX40L system (pOX40L and sOX40L) expression which may create a proinflammatory milieu for aggravating the development of atherosclerosis, and may be a valuable marker for predicting the severity of ACS.
18501882 Results show that the OX40-OX40L interaction suppresses IL-17 production by PHA-stimulated human PBMC and purified CD4 and CD8 cells.
18398332 Observational study of gene-disease association. (HuGE Navigator)
18356244 Our present findings, if corroborated in other prospective investigations, suggest that the TNFSF4 variants tested may be useful indicators for assessing the risk of venous thromboembolism.
18356244 Observational study of gene-disease association. (HuGE Navigator)
18174230 Observational study of gene-disease association. (HuGE Navigator)
18060034 OX40 ligand (OX40L) is a critical in vivo mediator of TSLP-mediated Th2 responses.
18059267 Observational study of gene-disease association. (HuGE Navigator)
17666213 TSLP-induced molecule on dendritic cells that triggers inflammatory T(H)2 differentiation in the absence of IL-12. Review.
17584577 study findings indicate that functional OX40L is inducible on human activated CD4+ and CD8+ T cells, and that the expression is enhanced by TGF-beta1
17185358 The demonstrate rapid infiltration of activated (OX40(+)) CD4(+) T cells into HSV-1-infected corneas and expression of OX40L on MHC Class II-negative cells, which are present in the infected corneas and required for HSK.
17166734 the quantitation of sOX40L was correlated with the age and among these subjects, those of 70s and 80s have much higher sOX40L concentration than those of 60s
17016617 Observational study of gene-disease association. (HuGE Navigator)
16924108 OX40 ligand (OX40L) completely inhibited the generation of IL-10-producing CD4(+) type 1 regulatory T (Tr1) cells from naive and memory CD4(+) T cells induced by the immunosuppressive drugs dexamethasone and vitamin D3.
16275760 OX40L on thymic stromal lymphopoietin-activated dendritic cells triggers T helper type 2 (Th2) cell polarization in the absence of IL-12, and can switch IL-10-producing regulatory Th cell responses into TNF-alpha-producing inflammatory Th cell responses.
16272289 OX40L costimulates human antiviral memory CD8 T cell responses largely through indirect effects and can enhance anti-influenza, anti-EBV, and anti-HIV responses, particularly in combination with 4-1BBL or B7.
15750594 Observational study of gene-disease association. (HuGE Navigator)
15750594 Single Nucleotide polymorphism in TNFS4 increase the risk of Arteriosclerosis
15470070 T cell proliferation by direct cross-talk between OX40 ligand on human mast cells and OX40 on human T cells.
15356117 Activated human natural killer (NK) cells are able to help T-cell receptor-stimulated autologous CD4+ T cells by a process that involves both OX40 ligand and B7 antigen costimulation.
15218969 an increasing amount of gp34/OX40L expression leads to an increasing level of up-regulation of the allogeneic CD4+ T-cell response by dendritic cells
15100674 Elucidation of cross-talk between OX40 and OX40L could be very important in understanding interaction of cells present in inflamed airways of asthma.
15034038 An OX40L-dependent mechanism is demonstrated in plasmacytoid dendritic cell-mediated T helper cell responses; OX40L selectively induces Th2-type immune responses by promoting CD4+ T cells to secrete IL-4, IL-5, and IL-13.
12798307 combined use of a vector driving the expression of OX40L with three other costimulatory molecules (B7-1, ICAM-1, and LFA-3) both enhances initial activation and then further potentiates sustained activation of nai;ve and effector T cells.
12624783 Expression of CD134 and CD134 ligand in lesional and nonlesional psoriatic skin.

AA Sequence

MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQSIKVQFTEYK      1 - 70
KEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMV     71 - 140
ASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL                               141 - 183
//

Text Mined References (119)

PMID Year Title
27008001 2016 Association of TNFSF4 (rs3850641) gene polymorphisms and coronary heart disease: an evidence-based meta-analysis.
26646413 2016 Comparative genomic analysis of eutherian tumor necrosis factor ligand genes.
26348892 2016 Analysis of a Genetic Polymorphism in the Costimulatory Molecule TNFSF4 with Hematopoietic Stem Cell Transplant Outcomes.
26125814 2015 Association between TNFSF4 tagSNPs and myocardial infarction in a Chinese Han population.
26070486 2015 OX40 Ligand Contributes to Human Lupus Pathogenesis by Promoting T Follicular Helper Response.
25359291 2014 Soluble OX40L is associated with presence of autoantibodies in early rheumatoid arthritis.
24999842 2014 Genome-wide association study of celiac disease in North America confirms FRMD4B as new celiac locus.
24679586 2014 IL2/IL-4, OX40L and FDC-like cell line support the in vitro tumor cell growth of adult T-cell leukemia/lymphoma.
24595151 2014 Absence of association between atherosclerotic cerebral infarction and TNFSF4/TNFRSF4 single nucleotide polymorphisms rs1234313, rs1234314 and rs17568 in a Chinese population.
24583911 2015 Eosinophilic inflammation of chronic rhinosinusitis with nasal polyps is related to OX40 ligand expression.
24091983 2014 Variants in TNFSF4, TNFAIP3, TNIP1, BLK, SLC15A4 and UBE2L3 interact to confer risk of systemic lupus erythematosus in Chinese population.
23953582 Blockade of OX40/OX40 ligand to decrease cytokine messenger RNA expression in acute renal allograft rejection in vitro.
23948416 2013 [Expressions and clinical significance of OX40 and OX40L in peripheral blood of patients with primary Sjogren's syndrome].
23936824 2013 A replication study from Chinese supports association between lupus-risk allele in TNFSF4 and renal disorder.
23874208 2013 Trans-ancestral studies fine map the SLE-susceptibility locus TNFSF4.
23740937 2013 A systemic sclerosis and systemic lupus erythematosus pan-meta-GWAS reveals new shared susceptibility loci.
23635951 2013 Association studies of TNFSF4, TNFAIP3 and FAM167A-BLK polymorphisms with primary Sjogren's syndrome in Han Chinese.
23622253 Association of TNFSF4 polymorphisms with susceptibility to primary Sjögren's syndrome and primary biliary cirrhosis in a Chinese Han population.
23589118 2013 Upregulation of OX40 ligand on monocytes contributes to early virological control in patients with chronic hepatitis C.
23469620 2013 OX40-OX40L expression in idiopathic inflammatory myopathies.
23273568 2013 Meta-analysis followed by replication identifies loci in or near CDKN1B, TET3, CD80, DRAM1, and ARID5B as associated with systemic lupus erythematosus in Asians.
23216302 2013 Genetic variation in the OX40L/OX40 system and plasma lipid and lipoprotein levels in a Chinese hypertriglyceridemic population.
23184501 2013 TNFSF4 gene polymorphism rs3861950 but not rs3850641 is associated with the risk of cerebral infarction in a Chinese population.
22870213 2012 Association of OX40L polymorphisms with sporadic breast cancer in northeast Chinese Han population.
22850862 2013 Association of TNFSF4 polymorphisms with systemic lupus erythematosus: a meta-analysis.
22847298 2012 Altered expression of TNFSF4 and TRAF2 mRNAs in peripheral blood mononuclear cells in patients with systemic lupus erythematosus: association with atherosclerotic symptoms and lupus nephritis.
22820624 2012 Associations between TNFSF4 and TRAF1-C5 gene polymorphisms and systemic lupus erythematosus: a meta-analysis.
22760717 2012 SOX40L: an important inflammatory mediator in adult bronchial asthma.
22646697 2013 OX40 ligand and OX40 are increased in atopic dermatitis lesions but do not correlate with clinical severity.
22422496 2012 Independent replication and meta analysis of association studies establish TNFSF4 as a susceptibility gene preferentially associated with the subset of anticentromere-positive patients with systemic sclerosis.
22156349 2012 Type I IFN-dependent T cell activation is mediated by IFN-dependent dendritic cell OX40 ligand expression and is independent of T cell IFNR expression.
21986129 2011 OX40 ligand levels and high-sensitivity C-reactive protein levels in blood from local coronary plaque and the femoral artery in patients with acute coronary syndrome or stable angina.
21820713 2011 Short ragweed pollen triggers allergic inflammation through Toll-like receptor 4-dependent thymic stromal lymphopoietin/OX40 ligand/OX40 signaling pathways.
21781408 Serum OX40 ligand levels in asthmatic children: a potential biomarker of severity and persistence.
21476935 2011 Association of OX40 and OX40L gene polymorphisms with acute coronary syndrome in a Han Chinese population.
21445270 2011 A common polymorphism in the promoter region of the TNFSF4 gene is associated with lower allele-specific expression and risk of myocardial infarction.
21441570 2011 Genome-wide meta-analysis for severe diabetic retinopathy.
21402531 2011 [Association study between TNFSF4 and coronary heart disease].
21397857 2011 Matrix metalloproteinase-2 conditions human dendritic cells to prime inflammatory T(H)2 cells via an IL-12- and OX40L-dependent pathway.
21239696 2011 HDAC11 plays an essential role in regulating OX40 ligand expression in Hodgkin lymphoma.
21187296 2011 A replication study confirms the association of TNFSF4 (OX40L) polymorphisms with systemic sclerosis in a large European cohort.
21143648 2011 Increased OX40 and soluble OX40 ligands in children with Henoch-Schonlein purpura: association with renal involvement.
21102463 2010 Genome-wide meta-analysis increases to 71 the number of confirmed Crohn's disease susceptibility loci.
21068098 2011 Study of the common genetic background for rheumatoid arthritis and systemic lupus erythematosus.
20962850 2011 A targeted association study in systemic lupus erythematosus identifies multiple susceptibility alleles.
20881011 2011 Early disease onset is predicted by a higher genetic risk for lupus and is associated with a more severe phenotype in lupus patients.
20861858 2011 Association of EBF1, FAM167A(C8orf13)-BLK and TNFSF4 gene variants with primary Sjögren's syndrome.
20848568 2010 Genetically determined Amerindian ancestry correlates with increased frequency of risk alleles for systemic lupus erythematosus.
20844189 2010 OX40 ligand regulates inflammation and mortality in the innate immune response to sepsis.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20568250 2010 Common single nucleotide polymorphisms in immunoregulatory genes and multiple myeloma risk among women in Connecticut.
20331378 2010 Large-scale candidate gene analysis of spontaneous clearance of hepatitis C virus.
20307208 2010 Control of immunity by the TNFR-related molecule OX40 (CD134).
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20190752 2010 Multiple common variants for celiac disease influencing immune gene expression.
20139223 2010 Airway wall expression of OX40/OX40L and interleukin-4 in asthma.
20012871 2011 A single-nucleotide polymorphism of the TNFSF4 gene is associated with systemic lupus erythematosus in Chinese Han population.
19951374 2010 Role of muscarinic receptor activation in regulating immune cell activity in nasal mucosa.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19838193 2009 Genome-wide association study in a Chinese Han population identifies nine new susceptibility loci for systemic lupus erythematosus.
19778912 2010 Association of TNFSF4 (OX40L) polymorphisms with susceptibility to systemic sclerosis.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19663699 2009 A novel agonist anti-human OX40L monoclonal antibody that stimulates T cell proliferation and enhances cytokine secretion.
19578796 2009 Association of genetic variants with chronic kidney disease in individuals with different lipid profiles.
19573080 2009 Common genetic variants in candidate genes and risk of familial lymphoid malignancies.
19494280 2009 Involvement of CD252 (CD134L) and IL-2 in the expression of cytotoxic proteins in bacterial- or viral-activated human T cells.
19357697 2009 Association of BANK1 and TNFSF4 with systemic lupus erythematosus in Hong Kong Chinese.
19092840 2009 Replication of the TNFSF4 (OX40L) promoter region association with systemic lupus erythematosus.
19083191 2009 Association of the co-stimulator OX40L with systemic lupus erythematosus.
19029970 2008 Lack of support for association between common variation in TNFSF4 and myocardial infarction in a German population.
19029446 2009 Prostaglandin E(2) enhances T-cell proliferation by inducing the costimulatory molecules OX40L, CD70, and 4-1BBL on dendritic cells.
18998106 2009 Genetic variants of TNFSF4 and risk for carotid artery disease and stroke.
18987746 2008 Association of interacting genes in the toll-like receptor signaling pathway and the antibody response to pertussis vaccination.
18832690 2008 Imidazoquinoline acts as immune adjuvant for functional alteration of thymic stromal lymphopoietin-mediated allergic T cell response.
18718855 2008 Rapid induction of OX40 ligand on primary T cells activated under DNA-damaging conditions.
18674525 2008 The clinical implications of increased OX40 ligand expression in patients with acute coronary syndrome.
18501882 Negative regulation of IL-17 production by OX40/OX40L interaction.
18398332 2008 Association of TNFRSF4 gene polymorphisms with essential hypertension.
18397322 2008 Activity of soluble OX40 ligand is enhanced by oligomerization and cell surface immobilization.
18356244 2008 Genetic variants of tumor necrosis factor superfamily, member 4 (TNFSF4), and risk of incident atherothrombosis and venous thromboembolism.
18174230 2008 Association of polymorphisms in complement component C3 gene with susceptibility to systemic lupus erythematosus.
18060034 2007 In vivo blockade of OX40 ligand inhibits thymic stromal lymphopoietin driven atopic inflammation.
18059267 2008 Polymorphism at the TNF superfamily gene TNFSF4 confers susceptibility to systemic lupus erythematosus.
17666213 2007 Thymic stromal lymphopoietin and OX40 ligand pathway in the initiation of dendritic cell-mediated allergic inflammation.
17584577 2007 Requirements for the functional expression of OX40 ligand on human activated CD4+ and CD8+ T cells.
17185358 2007 Expression and function of the OX40/OX40L costimulatory pair during herpes stromal keratitis.
17166734 2006 Development of a sandwich ELISA for evaluating soluble OX40L (CD252) in human sera of different ages or with Graves' disease.
17016617 2006 Genetic risk for atherothrombotic cerebral infarction in individuals stratified by sex or conventional risk factors for atherosclerosis.
16924108 2006 OX40 ligand shuts down IL-10-producing regulatory T cells.
16905106 2006 The crystal structure of the costimulatory OX40-OX40L complex.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16275760 2005 TSLP-activated dendritic cells induce an inflammatory T helper type 2 cell response through OX40 ligand.
16272289 2005 Evaluation of OX40 ligand as a costimulator of human antiviral memory CD8 T cell responses: comparison with B7.1 and 4-1BBL.
15750594 2005 Positional identification of TNFSF4, encoding OX40 ligand, as a gene that influences atherosclerosis susceptibility.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15470070 2004 T cell proliferation by direct cross-talk between OX40 ligand on human mast cells and OX40 on human T cells: comparison of gene expression profiles between human tonsillar and lung-cultured mast cells.
15356117 2004 Cross-talk between activated human NK cells and CD4+ T cells via OX40-OX40 ligand interactions.
15218969 2004 Lentiviral gp34/OX40L gene transfer into dendritic cells facilitates alloreactive CD4+ T-cell response in vitro.
15100674 2004 Detection and characterization of OX40 ligand expression in human airway smooth muscle cells: a possible role in asthma?
15034038 2004 Plasmacytoid dendritic cells regulate Th cell responses through OX40 ligand and type I IFNs.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12798307 2003 A recombinant vector expressing transgenes for four T-cell costimulatory molecules (OX40L, B7-1, ICAM-1, LFA-3) induces sustained CD4+ and CD8+ T-cell activation, protection from apoptosis, and enhanced cytokine production.
12624783 2003 Expression of CD134 and CD134 ligand in lesional and nonlesional psoriatic skin.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12134113 2002 Association of the CD134/CD134L costimulatory pathway with acute rejection of small bowel allograft.
11346458 2001 Expression of gp34 (OX40 ligand) and OX40 on human T cell clones.
11197696 2000 New variations in human OX40 ligand (CD134L) gene.
11069062 2000 Contribution of OX40/OX40 ligand interaction to the pathogenesis of rheumatoid arthritis.
10358148 1999 CD28-independent costimulation of T cells by OX40 ligand and CD70 on activated B cells.
9862675 1998 Ox-40 ligand: a potent costimulatory molecule for sustaining primary CD4 T cell responses.
9603911 1998 Molecular mechanisms of promoter regulation of the gp34 gene that is trans-activated by an oncoprotein Tax of human T cell leukemia virus type I.
9418902 1998 4-1BB and Ox40 are members of a tumor necrosis factor (TNF)-nerve growth factor receptor subfamily that bind TNF receptor-associated factors and activate nuclear factor kappaB.
9378971 1997 Expression and function of OX40 ligand on human dendritic cells.
9108415 1997 OX40 expressed on fresh leukemic cells from adult T-cell leukemia patients mediates cell adhesion to vascular endothelial cells: implication for the possible involvement of OX40 in leukemic cell infiltration.
8642328 1996 The human OX40/gp34 system directly mediates adhesion of activated T cells to vascular endothelial cells.
8076595 1994 Molecular characterization of murine and human OX40/OX40 ligand systems: identification of a human OX40 ligand as the HTLV-1-regulated protein gp34.
7913952 1994 Identification of a human OX-40 ligand, a costimulator of CD4+ T cells with homology to tumor necrosis factor.
1996093 1991 Molecular cloning and characterization of a novel glycoprotein, gp34, that is specifically induced by the human T-cell leukemia virus type I transactivator p40tax.