Property Summary

NCBI Gene PubMed Count 327
PubMed Score 1850.77
PubTator Score 896.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (26)

Disease log2 FC p
astrocytoma 1.300 5.7e-07
glioblastoma multiforme 1.800 1.8e-15
osteosarcoma -1.771 2.3e-02
group 4 medulloblastoma -1.800 1.8e-05
medulloblastoma, large-cell -2.100 5.3e-06
Duchenne muscular dystrophy 1.394 2.3e-07
juvenile dermatomyositis 2.298 5.5e-11
primary pancreatic ductal adenocarcinoma 1.037 2.7e-02
tuberculosis 1.200 4.8e-04
non-small cell lung cancer -1.001 5.9e-06
active Crohn's disease 1.709 1.8e-03
sarcoidosis 2.100 3.1e-02
Multiple Sclerosis 1.500 1.2e-02
interstitial cystitis 2.300 2.0e-03
cystic fibrosis 2.200 1.6e-02
adult high grade glioma 1.400 8.8e-03
pilocytic astrocytoma 2.200 3.8e-07
primary Sjogren syndrome 1.900 1.2e-04
subependymal giant cell astrocytoma 4.091 2.6e-03
invasive ductal carcinoma 2.212 2.1e-04
inflammatory breast cancer 1.700 6.4e-03
lung carcinoma -1.200 2.6e-13
gastric carcinoma 1.700 3.3e-02
ulcerative colitis 2.900 1.3e-07
ovarian cancer -3.300 4.8e-07
head and neck cancer and chronic obstruc... 1.400 8.6e-03

 GO Function (1)

Gene RIF (324)

PMID Text
27031098 Serum BAFF is unexpectedly found to be decreased in serum in response to the T cell independent immunogen Pneumovax 23.
26950089 Abnormal levels of BAFF/APRIL in pediatric acute lymphoblastic leukemia suggest that BAFF/APRIL are associated with the development and progression of this disease in children
26914861 expression levels of B cell-activating factor (BAFF) and B-cell maturation antigen were increased in multiple myeloma cells as compared with those in normal controls
26901523 The SNP BLYS -871C>T was associated with the frequency of IgG responders to PvAMA-1 and PvMSP-119.
26688003 Blood and salivary-gland BAFF-driven B-cell hyperactivity is associated to rituximab inefficacy in primary Sjogren's syndrome
26600308 The present study addresses how blood BAFF levels are associated with the clinical course of relapsing-remitting multiple sclerosis.
26590315 BAFF expression is directly induced by type I interferons via IRF1 and IRF2, whereas IRF4 and IRF8 are negative regulators of BAFF expression.
26461968 BAFF gene expression play an important role with transplant tolerance in patients receiving kidney transplants.
26424433 Serum BAFF was significantly higher in connective tissue disease-interstitial lung disease (CTD-ILD) patients compared to healthy subjects and chronic fibrosing interstitial pneumonia patients. BAFF was strongly expressed in CTD-ILD patient lungs.
26417991 role of TLR3/BAFF axis in IgA class-switch recombination of IgA nephropathy
26359802 High BAFF was associated with non-Hodgkin's lymphoma in primary Sjogren's syndrome.
26339644 Taking all the above together, BAFF is emerging as a biomarker of several malignancies and a possible hallmark of cancer cachexia
26327569 Negative expression of BAFF-R, but not of BAFF, could be an independent risk factor for progression-free survival and Overall survival in patients with diffuse large B-cell lymphoma treated with standard R-CHOP.
26268376 SNPs rs9514828 (BAFF), rs3803800 (APRIL) and rs4985726 (TACI) may be associated with the risk of development of B-cell chronic lymphocytic leukemia in a Polish population.
26266827 BAFF is significantly increased in lungs of patients with COPD and is present around both immune and stromal cells within lymphoid follicles.
26243624 results indicate that analysis of serum concentrations of BAFF and APRIL potentially represents a useful tool for the assessment of AIHA disease activity and progression.
26214745 BAFF and BAFF-R are expressed in the thyrocytes derived from patients with either autoimmune thyroid disorders or multinodular goiter, as well in the infiltrating immune cells of Graves' disease and Hashimoto's thyroiditis
26198030 we consider recent observations of BAFF and its receptors in RA progression, as well as the effects of BAFF on the cell-cell interactions network. We also summarize the clinical development of BAFF antagonists for the treatment of RA
26150532 the elevated presence of APRIL and BLyS in B cell-rich areas of chronically inflamed gingiva suggests that these cytokines may contribute to bone loss by promoting the survival and persistence of RANKL-expressing B cells/plasma cells.
26073875 Data support the hypothesis that B-cell BAFF expression creates a self-perpetuating loop contributing to COPD progression by promoting pulmonary B-cell survival and lymphoid follicle expansion.
25989238 Elimination of B lymphocyte stimulator receptor 3 (BR-3) and TACI or BR-3 and BCMA inhibits the development of SLE in NZM mice.
25849069 Cigarette smoke may hinder early mucosal IgA responses in the lung during influenza virus infection through oxidative inhibition of BAFF, which might contribute to the increased incidence and severity of viral infections in smokers.
25800158 A significant association was found between the BAFF -871C/T promoter polymorphism and MC, which may indicate that BAFF could be a potential therapeutic target in HCV-MC.
25759827 elevated serum levels in patients with Behcet's disease
25723853 Serum BAFF levels are significantly elevated in MM patients when compared to healthy controls, and correlate inversely with overall survival.
25656062 BAFF levels are significantly lower in maternal peripheral blood in pre-eclamptic pregnancies.
25637018 HIV-1-triggered release of interferon-alpha/interferon-beta by plasmacytoid dendritic cells induces BAFF production in monocytes.
25567522 serum levels elevated in the active phase of MPO-ANCA-associated renal vasculitis
25378636 HIV-1 Nef upregulates levels of B lymphocyte stimulator (BLyS) expression in monocyte-derived DCs
25360821 a critical role of miR-30a-3p in the regulation of BAFF expression
25339679 promotes Th17 cell-mediated immunity in Helicobacter pylori-induced gastritis
25162001 we confirmed the prognostic significance of soluble BLyS levels with regard to TFT in CLL patients, and, more importantly, we showed for the first time that sTACI is a powerful prognostic marker, related to parameters of disease activity
25152030 Letter: BAFF splice variants area differential expressed, but in a comparable ratio, in healthy controls and myositis patients.
25085377 Higher serum concentrations of BAFF in acute myeloid leukemia patients predicted a shorter overall survival.
25033258 Irrespective of HLA Ab status, sBAFF levels progressively increased in all patients in the first posttransplant year, thereafter reaching a plateau.
25013050 HIV-1 Nef upregulates levels of B lymphocyte stimulator (BLyS) expression in monocyte-derived DCs
25002077 Our data suggest that BAFF plays an important role in the pathogenesis of chronic inflammatory demyelinating polyneuropathy and may serve as marker for IVIg treatment response.
24993857 TLR9 mRNA and protein levels in peripheral blood mononuclear cells as well as serum levels of BAFF were significantly increased and may be associated with the overexpression of serum IgA1 in patients with immunoglobulin A nephropathy.
24968937 HIV-1 Nef upregulates levels of B lymphocyte stimulator (BLyS) expression in monocyte-derived DCs
24931438 Activation of human cytomegalovirus enhance the activation of BAFF expression in renal transplant recipients.
24906685 The strength of the antibody response to the nematode Ascaris lumbricoides inversely correlates with levels of B-Cell Activating Factor.
24889407 TNFRSF13C expression is reduced on CD19(+) cells in active ITP patients. This down-regulation occurs through a post-transcriptional mechanism and could be a consequence of chronic increase of TNFSF13B.
24864436 dectin-1 expression in conjunctival epithelial cells (CECs) was demonstrated, and expression of both dectin-1 and BAFF in CECs is thought to be involved in pathologic aggravation of allergic inflammatory in patients with vernal keratoconjuctivitis
24847941 BAFF expression is not specific to pseudomonas infection and may be a feature of the cystic fibrosis airway.
24811691 BAFF levels in chronic HBV infection are elevated, correlated with clinical diseases, and could be used as a biomarker for indicating disease mechanisms, activity, and diagnosis.
24809296 Availability of BAFF determines BAFF-R and TACI expression on B cells in common variable immunodeficiency.
24802131 Case Report: therapy with belimumab followed by rituximab may be effective for SS-related B-cell lymphoproliferation and overexpression of BAFF.
24800836 our findings demonstrate that the lymphoid microenvironment promotes survival, proliferation and progression of CLL cells via chronic activation of BCR, BAFF/APRIL and NF-kappaB activation while suppressing the immune response.
24780395 TLR4 activation increased BAFF production in mesenchymal stem cells.
24758362 BAFF expressed by B cells may play a pathogenic role in autoimmune bullous diseases, particularly bullous pemphigoid.
24728308 B lymphocyte stimulator (BLyS) is increased in human obesity.
24670802 This study suggests that BAFF suppresses IL-15 expression in autoimmune diseases
24667918 HIV-1 Nef upregulates levels of B lymphocyte stimulator (BLyS) expression in monocyte-derived DCs
24616478 B cells chronically exposed to high levels of BAFF were poised for rapid induction of aerobic glycolysis and metabolic reprogramming.
24602383 Our study demonstrates that BR3 is involved in the survival of cultured epithelial cells due to an autocrine effect of BAFF.
24534784 The levels of serum BAFF ligand are elevated in patients with myeloperoxidase-antineutrophil cytoplasmic antibodies-associated vasculitis.
24462743 In patients who did not develop chronic graft-versus-host disease, there is a temporal pattern of gradually decreasing BAFF levels as B cell numbers increase after myeloablative conditioning.
24435807 Data suggest that lack of BAFF prevents the procurement of B-cell-dependent help necessary for the emergence of destructive diabetes.
24411564 that BAFF can promote T cell activation, proliferation and differentiation.
24393484 overexpressed in myasthenia gravis thymus
24376672 BAFF and APRIL as well as their cognate receptors (BCMA, TACI) correlate with glioma grade. (Meta-analysis)
24289101 Results indicate a pathogenic role of B cells and B-cell activating factor (BAFF) in fibrosis and systemic sclerosis.
24252051 Our results suggest that an elevated level of BAFF/APRIL drives the maturation of B cells, subsequently leading to IgA2 class switching, and possibly to the development of interstitial lung disease in patients with mixed connective tissue disease.
24141333 Serum BAFF levels could be useful as a biomarker of multiple myeloma disease activity.
24084099 BAFF regulates T-cell survival by inducing osteopontin secretion in B cells in autoimmune diseases.
23940742 BAFF was elevated in patients with metastatic advanced pancreatic ductal adenocarcinoma.
23936794 BAFF seems to be an important growth factor for myeloma plasma cells. Measuring its serum levels, along with the previously mentioned cytokines, may provide important information regarding the degree of myeloma cells' proliferation
23884224 Polymorphisms in the regulatory region of the BAFF gene do contribute to the susceptibility to systemic lupus erythematosus.
23846230 Although neither serum BAFF nor APRIL correlated with disease activity in the overall population, elevated serum BAFF and reduced APRIL may be markers of renal and CNS disease in systemic lupus erythematosus patients
23845207 these findings suggest the implication of the host's genetic background in pSS-related lymphomagenesis. The interaction of pSS-related BAFF gene haplotypes together with distinct BAFF genetic variants appears to contribute to this complication.
23842189 In high immunologic risk patients undergoing antibody-incompatible kidney transplantation, the presence of elevated pretransplantation serum BAFF might identify those at increased risk of acute antibody-mediated rejection.
23773925 These findings suggest that elevated BAFF in chronic granulomatous disease subjects and healthy donors is a consequence of acute and chronic inflammation.
23768867 High serum BAFF is associated with multiple myeloma.
23686487 these findings show that ribosomal stress-induced SOCS3 plays a novel regulatory role in epithelial BAFF production
23685362 Serum BAFF levels can be used as a surrogate marker of disease activity in sarcoidosis patients. Increased BAFF may be related to the pathogenesis of sarcoidosis.
23684916 These data suggest that TNF-alpha-induced BAFF expression and BAFF-mediated VEGF expression in synovium may cooperate to protect B cells from apoptosis and the supply of nutrients and oxygen in inflammatory microenvironments.
23639027 Serum BAFF levels were significantly elevated in patients with systemic sclerosis irrespective of disease subtype, disease duration or age of patients.
23620746 The ability of TACI-Fc to activate reverse signalling through BAFF and APRIL, was investigated.
23604864 For the polymorphism in the BLYS gene, There were no statistically significant differences in the genotype and allele frequencies between the malaria and non-malaria groups.
23557796 findings show that excessive hsBAFF-elevated [Ca(2+)]i activated mammalian target of rapamycin signaling pathway, leading to proliferation and survival in B lymphocytes
23436580 Toll-like receptor 9 activation induces expression of membrane-bound BAFF on human B cells and leads to increased proliferation in response to both soluble and membrane-bound BAFF.
23342125 This study establishes for the first time BAFF as an acute phase reactant with predictive value for the course of acute pancreatitis.
23336587 Up-regulation of BLyS and its receptors, especially TACI are observed in patients with systemic lupus erythematosus.
23324534 Increased cerebrospinal fluid expression of BAFF protein is associated with severity of illness and neuroinflammation in children with opsoclonus-myoclonus syndrome.
23322463 We found a positive correlation of BAFF and DeltaBAFF expression with 3 disease activity measures in patients with idiopathic inflammatory myopathies.
23317407 The levels of serum BAFF and APRIL were raised in patients with anti-glomerular basement membrane disease and might be associated with disease activity and kidney damage.
23303823 High BAFF expression is associated with chronic graft-versus-host disease with bronchiolitis obliterans syndrome.
23276925 BLyS and its receptors are expressed by B lymphocytes in the peripheral blood and the bone marrow of patients with multiple myeloma.
23272079 BAFF-R, but not BAFF, may have a role in progression-free survival and overall survival in follicular lymphoma
23271704 IFN-gamma induces BAFF expression in human intestinal epithelial cells through JAK/STAT signaling pathways that might activate the GAS and IRF-1-binding element in the BAFF promoter.
23264555 The BAFF-871C>T polymorphism seems to influence the response to rituximab in rheumatoid arthritis patients after failure or intolerance to TNF blockers.
23088438 Systemic regulation of spinal cord injury-induced autoimmunity occurs via BAFF- mediated activation of B cells and B cell maturatin antigen (BMCA).
23039894 Serum levels of BAFF were increased in chronic HCV with MC.
22927996 BAFF serum levels were significantly higher in patients with active sarcoidosis
22898048 these results suggest that BAFF induced CD4(+) spleen T cell proliferation by down-regulating the phosphorylation of FOXO3A and then activating cyclin D2 and D3 expression, leading to CD4(+) T cell proliferation.
22896003 Elevated BAFF is associated with chronic Graft vs Host Disease.
22883025 data suggest that BAFF constitutes a risk factor for renal graft dysfunction and development of donor-specific antibodies. They also suggest that agents targeting BAFF-R interactions may offer new therapeutic opportunities in transplantation
22879463 Higher s-BLyS levels and tissue clonal B-cell expansion characterize Sjogren's syndrome with B-cell lymphoproliferative disorders.
22851468 Rituximab has differential effects on BAFF and APRIL levels in primary Sjogren's syndrome patients
22850273 These findings suggest that JNK activation and BLyS expression in multiple myeloma (MM) cells may form a positive feedback loop that promotes the survival and proliferation of MM cells.
22822003 Single nucleotide polymorphisms that result in increased BAFF are potentially relevant for chronic graft versus host disease pathophysiology.
22752534 increased serum levels of BLyS and APRIL in BD patients supports the notion of a critical role for B cell activation factors in BD, particularly in terms of uveitis and disease activity.
22749832 The complexity of the various forms of BAFF has profound implications for autoimmunity. (Review)
22736090 The monocyte IFN type I signature identifies a subgroup of patients with Sjogren syndrome with a higher clinical disease activity together with higher BAFF mRNA expression.
22728080 study evaluated polymorphisms in viral response genes and found an intronic SNP in the BAFF gene associated with asthma exacerbations in African Americans in 2 of 3 cohorts of patients; this SNP was associated with higher levels of BAFF compared with subjects homozygous for G allele
22719887 found that the BAFF/APRIL system was closely related to the Th1 immune response. Our study delineates previously unreported roles of BAFF and APRIL in the development of tuberculosis
22718279 findings show decidual stromal cells and follicular dendritic cells shared some of each other's distinctive features such as expression of B cell-activating factor, C-X-C motif chemokine 13 secretion and the capacity to rescue B cells from apoptosis
22593611 These data indicate that BAFF, APRIL, and CD40L form a Chronic lymphocytic leukemia -enhancing bidirectional signaling network linking neoplastic B cells with the microvascular stroma.
22575417 Our study results suggest that BAFF might play an important role in the pathogenesis of Dermatomyositis
22537850 Protein kinase C stimulates human B cell activating factor gene expression through reactive oxygen species-dependent c-Fos in THP-1 pro-monocytic cells
22531553 In patients with IgG4-related disease, serum BAFF levels are significantly higher than in healthy individuals.
22526370 BAFF serum levels in multiple myeloma patients increased in advanced stages & decreased in plateau phase. BAFF may play an important role in the pathogenesis of MM.
22516957 BAFF-transgenic mice manifest an expansion of peritoneal B1 cells that express lower levels of FcgammaRIIb and exhibit reduced susceptibility to apoptosis.
22498341 Higher BAFF levels predicted a shorter survival, suggesting an important prognostic marker and a possible therapeutic target in myeloma.
22463935 the expression level of BlyS was increased in human breast cancer cell lines in hypoxic conditions. Up-regulation of this protein led to activation and nuclear translocation of NF-kappa B p65.
22399512 We report that serum BAFF concentrations are elevated in patients with Graves disease, in whom hyperthyroidism is known to be based on a B-cell-driven pathophysiological mechanism.
22340436 data suggested that BAFF was produced within the central nervous system and may be associated with the development of Neuro-Behcet's disease
22338013 study showed that functional polymorphism in the promoter region of the BAFF gene is associated with better overall survival of patients with T-cell lymphomas
22325420 BAFF-specific inhibitor AMG623 peptibody reduces B-cell number and improves outcomes in murine models of autoimmune disease.
22169295 BAFF and APRIL gene expression in multiple myeloma cells is down-regulated after glucocorticoid and bortezomib treatment.
22124120 Soluble BAFF levels inversely correlate with peripheral B cell numbers and the expression of BAFF receptors.
22102726 Although BAFF/APRIL inhibition increases the stringency of negative selection of the naive autoreactive B cell repertoire in chimeric mice, it does not correct the major breach in B cell tolerance at the germinal center checkpoint.
22059379 APRIL and BAFF proteins increase proliferation of human adipose-derived stem cells through activation of Erk1/2 MAP kinase.
22018243 Monocyte production of soluble BAFF from patients with primary Sjogren's syndrome is significantly higher than in normal monocytes; the amount of interleukin (IL)-6 produced is also noticeably increased.
21889147 FURIN and its substrate cytokines BAFF and APRIL are over expressed in atherosclerotic plaques.
21883351 results point to a possible association between BLyS -817C/T polymorphism and idiopathic infertility in Brazilian population
21849293 In summary, this study suggests a potential role for BAFF during malaria disease, both as a marker for disease severity and in shaping the differentiation pattern of antigen-specific B cells.
21790703 elevated serum levels in patients with autoimmunity and lymphoproliferation
21765951 The expression of these BAFF, APRIL and TWEAK was analyzed in atopic eczema, seborrheic eczema (SE) and healthy controls (HC).
21747319 B Cell-activating factor could be a novel marker for diagnosis and treatment response in autoimmune pancreatitis and may contribute to its pathogenesis.
21733733 Our results suggest increased BAFF and APRIL serum levels in juvenile idiopathic arthritis patients denoting their possible role in the disease.
21707303 Data show that the combined analysis of BAFF and APRIL serum levels emerged as an independent predictor of disease progression.
21632709 Peripheral tolerance mechanisms regulate the frequency of autoreactive follicular B cells independent of the BLyS transgene pathway.
21628416 This study shows that genetic variation of BAFF modulates GVHD phenotype after allogeneic stem cell transplantation
21559937 serum BAFF levels are increased in myasthenia gravis
21557212 results suggest that fibroblast-like synoviocytes can induce class switch recombination through a BAFF-dependent mechanism
21538321 transcriptional activation induced by the particular allelic variant of BAFF promoter can be considered one of the mechanisms contributing to the pathogenesis of hepatitis C virus-related autoimmune/lymphoproliferative disorders
21537154 871C>T BAFF gene polymorphism expression may have a role in chronic ITP disease
21518495 BAFF and BCL-2 may be involved in occurrence and development of multiple myeloma.
21505913 Data indicate that BAFF and APRIL can induce inflammatory activation of THP-1 cells through the activation of their receptors (TAC1, BAFF-R, and BCMA) and MAPK, which leads to the subsequent activation of NF-kappaB.
21483105 This is the first study, presenting together the TNFSF members APRIL, BAFF, TWEAK and their receptors in different areas of normal renal tissue and renal cell carcinoma.
21372118 BAFF/CXCL12 may work in concert to affect B-cell homeostasis in multiple sclerosis and contribute to the pathophysiology of the disease.
21293157 Serum BAFF accumulation is higher in active vasculitis patients than in inactive vasculitis, infectious complication and control patients.
21239754 Data suggest that elevated B cell activation factor (BAFF) expression supports expansion of the T2 B cell compartment and contributes to a breach in tolerance in patients with systemic lupus erythematosus.
21211990 Data show negative correlations for BAFF concentration vs blood B cell percentage and serum CXCL13 concentration.
21177756 Interferon-beta increases systemic BAFF levels in multiple sclerosis without increasing autoantibody production.
21145253 Human soluble BAFF may promote CD4(+) T cell proliferation and response by upregulation of [Ca(2+)](i) homeostasis.
21051868 BAFF induction by viral infection is a general phenomenon, but the types of viruses and mechanisms of the induction depend on the cell type.
21039888 TLR7 regulates DC-dependent B-cell responses through BlyS in the pathogenesis of ITP
20974656 Elevated plasma BAFF and reduced BR3 protein expression on peripheral B cells could act as biomarkers for active disease in systemic lupus erythematosus patients
20956327 an important relationship between BAFF and c-MYC in CLL which may affect disease development and progression, and suggests that inhibitors of the canonical NF-kappaB pathway may be effective in treatment of patients with this disease.
20935029 We found significantly higher levels of BAFF in the cerebrospinal fluid of neuromyelitis optica patients compared with that in Multiple sclerosis
20927378 TNFSF13B is a positional candidate preeclampsia susceptibility gene on chromosome 13q.
20927378 Observational study of gene-disease association. (HuGE Navigator)
20890272 This is the first study, which details local expression of APRIL and BLyS in glomeruli and tubulointerstitium of human proliferative lupus nephritis.
20870901 High expression levels of B lymphocyte stimulator by dendritic cells correlate with HIV-related B-cell disease progression.
20813000 Meta-analysis of gene-disease association. (HuGE Navigator)
20802378 Observational study of genetic testing. (HuGE Navigator)
20646006 Findings indicate that IREM-1 exerted its inhibitory effect on BAFF-medicated signalling through ITIM-mediated regulation of ERK activities in THP-1 cells.
20568250 Observational study of gene-disease association. (HuGE Navigator)
20561430 The polymorphism -871 C/T of BAFF promoter is correlated with the pathogenesis of immune thrombocytopenic purpura.
20561430 Observational study of gene-disease association. (HuGE Navigator)
20546021 in early B-cell CLL, the biological profile including among other parameters soluble BAFF may provide a useful insight into the complex interrelationship of prognostic variables
20428981 Although BAFF inhibited apoptosis by Burkitt lymphoma cells, it failed to inhibit apoptosis by B cell precursor acute lymphoblastic leukemia cells.
20357250 TLR4 in immature B cells directly obtained from fresh bone marrow results in the generation of CD23-positive B cells upon overnight stimulation with lipopolysaccharide.
20302641 A novel immunoassay demonstrated that native BLyS/APRIL heterotrimers, as well as BLyS and APRIL homotrimers, are elevated in patients with autoimmune diseases.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20089415 These results indicate that human nasal airway fibroblasts strongly induce BLyS-expression and production by poly(I:C) through PI3-K signaling during airway immune responses.
20004378 Patients with deep infiltrating endometriosis had less often a BLyS -817C/T genotype as compared with the reference group.
20004378 Observational study of gene-disease association. (HuGE Navigator)
19935379 BAFF seems to support the rate of circulating B-cell repopulation after rituximab treatment and may play a role in regulating differences in B-cell homeostasis.
19909733 The levels of APRIL, BlyS and receptors as TACI, BCMA and BAFF-R in peripheral blood mononuclear cells of cryptococcal meningitis patients and its clinical significance, was investigated.
19877053 Plasma BLyS protein and blood leukocyte BLyS mRNA levels are elevated in pediatric systemic lupus erythematosus. Plasma BLyS protein levels are normal in juvenile idiopathic arthritis despite elevated blood leukocyte BLyS mRNA levels.
19863844 Data show that mesenchymal stromal cell interaction with B cells supports B-cell survival and may contribute to the pathogenesis of rheumatoid arthritis, and suggest that factors other than B cell-activating factor may contribute to this effect.
19841639 The reverse signaling initiated from BAFF induces the expression of inflammatory mediators while suppressing the cytoskeletal movements associated with phagocytosis and transmigration.
19840904 BAFF may serve as a modulator of the clinical and/or serological manifestation in primary biliary cirrhosis
19828625 BAFF and its receptor BCMA are novel potential mediators of adipogenesis and have a specific role in immunity, which is defined by immature and mature adipocytes as their source.
19794139 BAFF may play a pathogenic role in immune thrombocytopenia
19774453 higher plasma concentrations in systemic lupus erythematosus patients
19773279 Observational study of gene-disease association. (HuGE Navigator)
19758161 Results show that IgAD patients had a significant increase of BLyS (P < 0.0001) and APRIL (P = 0.003) levels, and no differences were seen between patients with or without CD.
19731825 BLyS and its receptors might have a potential role in the growth and survival of malignant plasma cells.
19604268 Observational study of gene-disease association. (HuGE Navigator)
19565488 B cells contribute to the enhanced levels of circulating BAFF and APRIL in patients with systemic lupus erythematosus.
19545677 Expression of BAFF in peripheral blood sample from kidney transplant recipients indicate that BAFF may be involved in the development of graft loss.
19499314 Both plasma concentration and mRNA are increased in autoimmune thrombocytopenia, and are decreased folloiwing dexamethasone treatment
19439611 Nogo-66 receptor (NgR)is identified as a high affinity receptor for BLyS; BLyS can function independently of myelin-associated inhibitors & likely serves as a redundant NgR ligand that negatively influences axonal outgrowth in the central nervous system
19421221 Single nucleotide polymorphism in BLYS is associated with pemphigus foliaceus.
19421221 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19395025 Patients with a low percentage of leukemic cells with intracellular BAFF or APRIL expression had a significantly longer overall survival than those with a high proportion of APRIL or BAFF positive leukemic cells.
19393234 Results demonstrated that IL-10 and IFN-gamma both regulate B-cell activating factor expression and synthesis in human promyelocytic leukemia cell cultures, and the activation occurs at the transcriptional level.
19383901 Genetic variation in the TNFSF13B gene is significantly associated with non-Hodgkin lymphom and elevated serum levels.
19383901 Observational study of gene-disease association. (HuGE Navigator)
19366834 Lack of epithelial BAFF gene expression in prostate cancer is associated with tumor escape from immunosurveillance.
19339060 These data indicate that an activated B-cell system in the cerebrospinal fluid is involved in the pathogenesis of OMS, and BAFF may be a candidate parameter for the activation of B-cell immune system.
19291294 overexpression and association with tumor progression in many human tumor types - brain, epithelial, lymphoid, germ cells
19249491 Level of this material may be associated with the development of antibody-mediated allograft rejection in kidney transplantation.
19190830 Case Report: Elevation of B cell-activating factor belonging to the tumour necrosis family family (BAFF) in haemophilia A patients with inhibitor.
19175985 Over-expression of BLyS/April may be one of factors contributed to the immunological dysfunction in acute idiopathic thrombocytopenic purpura.
19168788 In cGVHD, increasing BAFF concentrations correlated with increased numbers of circulating pre-germinal center (GC) B cells and post-GC "plasmablast-like" cells, suggesting in vivo BAFF dependence of these 2 CD27(+) B-cell subsets
19135236 The antigen-induced production of BAFF in the airway might contribute to local class-switch recombination and immunoglobulin synthesis by B cells.
19124722 T cell responses in BAFF-transgenic mice are profoundly compromised, as indicated by their acceptance of islet allografts and delayed skin graft rejection.
19118513 These results indicate that BAFF may be involved in the development of graft-loss and influences the long-time outcome of kidney allograft, likely mediated by interfering with immune response.
19074885 Observational study of gene-disease association. (HuGE Navigator)
19051265 BLyS serum levels significantly increase, independent of SNPs rs12428930, rs12583006, rs1224141, & rs9514828), after rituximab therapy. These high levels may promote the proliferation of residual malignant B-cells explaining rituximab failure.
19028483 BLyS protein concentration and BLyS, TACI and BAFF-R mRNA expression levels were significantly elevated in patients with multiple myeloma.
19026118 Serum BAFF (B-cell activating factor )levels were elevated in patients with active Behcets disease compared to the healthy controls, and correlated positively with the extent of skin lesions.
19005881 BAFF might contribute to autoimmunity and disease development in ITP. However, BAFF serum level must be carefully considered as a surrogate marker of disease activity in ITP.
18988879 investigation of the role of BAFF promoter polymorphism in HCV-related mixed cryoglobulinemia patients as a genetic contributor to its pathogenesis
18852352 We report that BAFF levels are increased in patients with autoimmune MG. Our data suggest that BAFF is likely to play a role in the pathogenesis of MG by promoting the survival and maturation of autoreactive B cells.
18843286 non-Hodgkin's B lymphoma cell adhesion to bone marrow stromal cells augmented BAFF secretion twofold through upregulation of BAFF gene expression, protecting lymphoma cells from apoptosis.
18784835 Human BLyS facilitates engraftment of human PBL derived B cells in immunodeficient mice
18775026 We propose that an aberrant BAFF/BAFF-R-dependent autocrine mechanism may play a role in the development of certain types of nonhematopoietic cancer cells.
18718031 There are elevated levels of BAFF and APRIL in cerebrospinal fluid of systemic lupus erythematosus (SLE) patients. APRIL was augmented in neuropsychiatric SLE patients compared with SLE patients without central nervous system involvement.
18715196 BAFF is a good biomarker for IFN-beta response, and requires further studies to determine its value as a marker for clinical response and NAb predisposition.
18687360 hsBAFF results in the elevation of NK cell activity by regulation of CD4(+) T lymphocytes contributing to IL-2 and IFN-gamma generation
18668552 Circulating BLyS levels and systemic lupus erythematosus (SLE) are positively correlated. BLyS is a candidate for therapeutic targeting in SLE.
18641361 overexpression of IFN-gamma in peripheral blood T cells contributes to the immunopathogenesis of systemic lupus erythematosus via the induction of sBLyS by monocytes/macrophages
18637712 hsBAFF-upregulated intracellular free Ca(2+) homeostasis regulates ERK1/2 activity and cell proliferation in B cells in vitro.
18628489 Autocrine BAFF signal transduction pathways may contribute to Helicobacter pylori-independent growth of gastric DLBCL (MALT).
18625509 Report bioassay for human BAFF based on expression of a mouse BAFF-receptor ectodomain-human tumour necrosis factor-related apoptosis-inducing ligand (TRAIL) receptor-2 endodomain fusion receptor in human rhabdomyosarcoma cells.
18617551 susceptibility for Ro/La-positive primary Sjogren's syndrome (pSS) is increased with the CTAT haplotype, but not with high s-BAFF levels; elevated s-BAFF in pSS are associated with the TTTT haplotype & may be a secondary phenomenon in Ro/La-positive pSS
18606652 These results provide a mechanism by which Fcgamma receptors can elevate circulating BLyS levels and promote autoantibody production in immune complex-mediated autoimmune diseases.
18586330 BAFF might play a role in the immunopathogenesis of myasthenia gravis.
18566393 viral dsRNA may initiate frontline IgG and IgA responses through an innate TLR3-dependent pathway involving BAFF
18556064 only feature characterizing familial CLL patients was a higher serum BAFF level (sporadic CLL 336 ng/mL, range 93-925; familial CLL 601 ng/mL, range 138-8914; P=0.002). Our data suggest that BAFF levels are elevated in patients with familial CLL
18551073 In certain patients, inflammatory microenvironment provides BAFF-dependent paracrine survival signal to B-cells in TLOs, allowing them to escape rituximab-induced apoptosis, thereby thwarting therapeutic efficiency.
18528969 Elevated BAFF (B-cell activating factor) in a subset of ERA patients is related to autoantibody levels and synovitis
18490739 data suggest that BLyS may modulate adaptive immune cells indirectly by inducing dendritic cell maturation
18410958 Overproduction of BAFF in nasal polyps may contribute to the pathogenesis of chronic rhinosinusitis with nasal polyps
18403603 there are potential autocrine and paracrine pathways for BAFF and APRIL signaling in human placentas suggest that lineage-specific regulation of placental cell viability, differentiation and/or other activities may be novel functions of these proteins
18366696 the constant expression of BAFF, in adipocytes, normal breast cells and their cancer counterparts, might be relevant of the trophic potency in breast, promoting the proliferation and development of normal and malignant breast tissue.
18350548 BAFF induction by target organs of autoimmune diseases after viral infection may be a link between innate immunity and autoimmunity
18328673 serum BAFF is elevated and appears to play an important role in the development of alopecia areata
18249037 The roles of BAFF protein and interferon gamma in IgA production of tonsillar mononuclear leukocytes in patients with IgA nephropathy.
18243342 BAFF inhibits Fas-mediated cell death, however, the BCR-driven survival signals were not strengthened by BAFF, therefore, BAFF may function independently of the antigen specificity of BCR.
18204790 Elevated BAFF and APRIL expression levels might partially reflect the common immunological feature of primary antibody deficiency.
18174230 Observational study of gene-disease association. (HuGE Navigator)
18172003 These findings indicate a previously unreported role for the BAFF/BAFF-R pair in mature B-cell chemotaxis.
18064389 All of these results indicated that the abnormally high expression of BAFF on T lymphocytes from MPE may play a role of anti-tumor effect.
18050196 IFNalpha activity and BAFF levels are elevated in the plasma of patients with Sjogren's syndrome compared with healthy controls.
17988587 The levels of serum BAFF and IL-21 level are increased in the patients with SLE.
17963166 Widely expressed in the synovial tissue of patients with rheumatoid arthritis.
17947475 BAFF has a role in B-cell activation in patients with active chronic graft-versus-host disease
17942754 TACI supported survival of activated B cells and plasmablasts in vitro
17908986 BAFF has a role as a survival factor in multiple myeloma
17907168 findings indicate that BAFF secretion by resident cells in target organs of autoimmunity is tightly regulated by innate immunity, with positive and negative controls, depending on the receptors and the pathways triggered
17896803 Results suggest that elevated serum APRIL and BAFF levels are differentially associated with disease severity in systemic sclerosis.
17825416 Low levels of the BAFF TVs in all lymphocyte subpopulations analyzed suggest that their main source in PBMC are monocytes.
17640886 suggest a model for the pathology of endometriosis where BLyS-responsive plasma cells interact with retrograde menstrual tissues to give rise to endometriosis lesions
17592744 BAFF playsan important role in the pathogenesis of idiopathic thrombocytopenic purpura by activating B cells.
17584580 results suggest that BAFF contributes to liver injury and disease development in autoimmune hepatitis patients
17556024 Peripheral blood mononuclear cells of CVID subjects had increased levels of BAFF mRNA.
17530706 As neutrophils enter the site of inflammation, they release surface-expressed BLyS in a TNFalpha-dependent manner, and thus may contribute to local stimulation of autoimmune B cell responses.
17469105 The timing of B cell repopulation in rituximab-treated Sjogren's syndrome patients is modulated by BAFF and is followed by reconstitution of the preexisting abnormalities.
17442944 These data define a complex role for BAFF in humoral immune responses and show for the first time that BAFF can also play an inhibitory role in B cell differentiation.
17393290 anti-BAFF IgG might amend deleterious effects of BAFF in B-cell-mediated autoimmune diseases
17346422 BAFF levels are elevated in the serum of autoimmune patients--{REVIEW}
17296586 B-lymphocyte stimulator (BLyS) plays a critical role in the survival of B-lymphocytes and has a role in progression of Hodgkin's lymphoma
17257595 These results indicated that the recombinant BAFF mutants modified with Th epitopes could induce neutralizing antibodies against BAFF in vivo.
17119117 recombinant gelonin/B lymphocyte stimulator fusion toxin may have potential therapeutic efficacy for B-CLL patients
16931039 Review. Direct BAFF/APRIL signalling in T cells and/or T cell modulation in response to a BAFF-modified B cell compartment may play an important role in inflammation and immunomodulation.
16931038 Review. BAFF and its receptor have roles in B cell biology outside of a survival mechanism. These include germinal center maintenance, isotype switching, and regulation of specific B cell surface markers.
16931037 Review. Signal cascades that effect BLyS- dependent survival, regulation of BLyS signaling, BLyS as a growth factor & BLyS- induced metabolic enhancement in B cell response to BCR and TLR-dependent signaling.
16919470 Review. BLyS signaling via BR3 is the dominant homeostatic regulator of primary B cell pools.
16916610 Review. Defects in the production of BAFF and/or expression of its receptors have been associated with a diverse array of human immunopathologies characterised by perturbed B cell function and behaviour, like autoimmunity, malignancy, & immunodeficiency.
16916609 Review. BAFF is required for mature B cell development and survival but causes B cell hyperplasia and autoimmunity when it is overexpressed.
16914324 Review. The splice variants, binding specificities, structural determinants for ligand selectivity, and signaling pathways are reviewed.
16863659 BAFF has provided considerable new insight into B cell homeostasis and immune function, and represents an important new molecular target for treatment of autoimmune diseases and lymphomas--{REVIEW}
16840730 BR3, which is expressed on all mature B cells, is a specific receptor for the B-cell survival and maturation factor BAFF.
16838132 patients with CVID were screened using DHPLC and direct sequencing: No disease causing mutations were identified. A novel heterozygous single nucleotide polymorphism(G189A), which does not lead to an amino acid substitution, was found in one individual.
16825497 high BLyS production is often correlated with certain inflammatory autoimmune diseases and B-lymphocyte malignancies
16818641 BAFF secretion is 3- to 10-fold higher in bone marrow stromal cell than in multiple myeloma cells; tumor cell adhesion to BMSCs augments BAFF secretion by 2- to 5-fold, confirmed by both ELISA and immunoblotting.
16802367 BAFF (the assistance of which is required for proper transformation of transitional TI B cells into transitional TII B cells) accumulated adjacent to transitional and marginal-zone-like B lymphocytes in Sjogren's syndrome.
16740602 expression of BAFF was regulated through a signal transduction pathway which involves c-jun NH2-terminal kinase and p38
16623930 The addition of Qn to previous therapeutic regimens in active SLE is beneficial and seems to reduce SLEDAI scores, serum BAFF and aCL levels and therefore should be considered in many of our SLE patients before aggressive treatments are given.
16604261 results indicated that four residues, H218, F220, T228 and L229, are indispensable for the biological activity of cBLyS, whereas two regions, amino acid 134-148 and amino acid 271-285, are related to the biological activity of BLyS.
16547227 Chronic activation of B cells through this CD40-independent pathway could impair protective T cell-dependent antibody responses by inducing immune exhaustion
16547227 HIV-1 Nef upregulates levels of B lymphocyte stimulator (BLyS) expression in monocyte-derived DCs
16507129 Observational study of gene-disease association. (HuGE Navigator)
16507129 BAFF gene polymorphism is neither involved in genetic predisposition to primary Sjogren's syndrome nor associated with a specific pattern of antibody production.
16497967 NFKB and NFAT regulate BLyS expression via at least one NFKB and 2 NFAT BLYS promoter binding sites. Constitutive activation of NFKB and BLyS in NHL-B cells forms a positive feedback loop associated with lymphoma cell survival and proliferation
16475789 Ala134-BAFF is more efficacious than myc-Gln136-BAFF in inducing B cell proliferation. Formation of the 60-mer in solution by BAFF extracellular domain is an intrinsic property of the protein. This more active form of BAFF may be physiologically relevant.
16356193 Full-length BLyS and DeltaBLyS mRNA levels are elevated in systemic lupus erythematosis and are more closely associated with disease activity than are BLyS protein levels.
16304043 BLyS was found to increase the viability and proliferation of malignant B cells from Waldenstrom macroglobulinemia patients.
16301744 B cell homeostasis is maintained by BAFF-mediated regulation of Bcl-2-binding protein, BIM.
16242914 In Wagener's granulomatosis (WG) patients, serum levels of BAFF are significantly increased, therefore BAFF is proposed to be a possible pathogenic factor in WG.
16239971 BLyS regulates B cell as well as T cell function and has pro- and antiinflammatory activities in rheumatoid arthritis.
16052575 The known effect of B cells in periodontitis would be partly mediated by salivary BAFF in patients with primary Sjogren's syndrome.
15981083 Serum levels of sBAFF and sAPRIL were increased in Sjogren's syndrome, especially in anti-Ro/La+ patients
15860672 conclude that BAFF and APRIL from NLCs can function in a paracrine manner to support leukemia cell survival via mechanisms that are distinct from those of SDF-1alpha
15843552 BAFF transgene overexpression in vivo promotes delayed-type hypersensitivity, which is a classical type 1 T-helper (Th1) cell response, and suppresses Th2-dependent allergic airway responses.
15827134 show that the main site of production for BAFF and APRIL is the bone marrow (BM) environment, and that production is mainly by monocytes and neutrophils. In addition, osteoclasts produce very high levels of APRIL, unlike BM stromal cells
15728515 Macrophages promote Burkitt's lymphoma cell survival through a B-cell survival factor (BAFF)-dependent mechanism.
15634908 The induced expression of BAFF on fibroblast-like synoviocytes by proinflammatory cytokines in vitro may enhance the capacity of such cells to protect B cells from apoptosis in inflammatory microenvironments in vivo.
15542592 another form of TACI exists wherein the N-terminal cysteine-rich domain (CRD) is removed by alternative splicing and is capable of ligand-induced cell signaling and that the second CRD alone (TACI_d2) contains full affinity for both APRIL and BAFF
15470519 Review. BLyS plasma levels in systemic lupus erythematosus, Sjogren's syndrome & rheumatoid arthritis are higher in patients than controls. BLyS may have a role in the interaction between the monocyte & the B lymphocyte in some autoimmune disease.
15358625 novel mechanism that might dramatically exacerbate the release of BLyS by neutrophils during pathologic inflammatory responses.
15251985 BLyS and its receptors represent a potentially important therapeutic target in B-cell lymphoma
15230285 Antagonissts may provide treatment for systsemic lupus erythematosus (REVIEW)
15070697 serum levels of BAFF and APRIL were increased about 5-fold in patients with multiple myeloma as compared with healthy donors
14978135 Exposure of non-Hodgkin's lymphoma B cells to recombinant or myeloid cell-derived BAFF attenuates apoptosis, increases NF-kappa B activation, up-regulates Bcl-2 and Bcl-xL, and down-regulates Bax.
14673998 Dysregulation of BLyS over extended periods of time is common in patients with systemic lupus erythematosus
14630796 BAFF may play an important role in FDC-B-cell interactions through the B-cell coreceptor complex and a possibly sequential link between the T cell-independent and -dependent B-cell responses in the germinal centers.
14607922 BAFF up-regulates activation-induced cytidine deaminase and enhances class-switch DNA recombination in Epstein-Barr virus-infected B cells.
14504101 B-CLL cells can be rescued from apoptosis through an autocrine process involving BAFF, APRIL, and their receptors.
12867412 alternative splicing of the BAFF gene regulates receptor binding and biopresentation of the B cell survival cytokine, BAFF
12865416 BAFF may enhance humoral immunity in vivo by promoting survival of Ig-secreting cells via a B cell maturation antigen-dependent mechanism
12755599 BAFF/BLyS receptor 3 comprises a minimal TNF receptor-like module that encodes a highly focused ligand-binding site.
12715002 crystal structure and interactions with BAFF receptor
12531790 macrophage- and DC-derived BAFF is a key molecule by which macrophages and DCs directly regulate human B-cell proliferative responses to T-cell-independent stimuli.
12424625 Observational study of gene-disease association. (HuGE Navigator)
12408045 Review. BLyS is one of the most important cytokines of the TNF superfamily. It supports normal B-cell function & promotes B-cell autoimmunity.
12389615 REVIEW: role in regulating the peripheral B cell compartment and humoral immunity, and the contribution of altered BLyS expression to B lymphocyte diseases
12370363 When coexpressed with APRIL, BLYS forms active heterotrimeric molecules that circulate in the serum of patients with systemic immune-based rheumatic diseases.
12351410 aberrantly expressed by B chronic lymphocytic leukemia cells
12154359 BLyS and APRIL critically link the innate and adaptive immune responses.
12149433 10 genes, including interleukin (IL)-10, lymphocyte activation gene-1 (LAG-1), GCP-2, PBEF, ferritin, PIM-2, TFG, CD27 ligand, DUSP5, and archain, were up-regulated at the mRNA level by TALL-1 stimulation in B lymphoma cells and/or primary B lymphocytes.
12115621 BAFF is a survival and maturation factor for mouse B cells
11862220 determined the three-dimensional crystal structure of BLyS to 2.0 A resolution and identified receptor recognition segments using limited proteolysis coupled with mass spectrometry
11827482 crystal structure of the TNF-homologous domain
11823048 Levels of BLyS protein were, on average, threefold higher in patients with follicular lymphoma compared to normal donors
11714784 BAFF may play a role in the development of T cell responses, in addition to its role in B cell homeostasis.
11509692 interacts with newly identified receptor BAFF-R, which appears to be the principal receptor for BAFF-mediated mature B cell survival

AA Sequence

MDDSTEREQSRLTSCLKKREEMKLKECVSILPRKESPSVRSSKDGKLLAATLLLALLSCCLTVVSFYQVA      1 - 70
ALQGDLASLRAELQGHHAEKLPAGAGAPKAGLEEAPAVTAGLKIFEPPAPGEGNSSQNSRNKRAVQGPEE     71 - 140
TVTQDCLQLIADSETPTIQKGSYTFVPWLLSFKRGSALEEKENKILVKETGYFFIYGQVLYTDKTYAMGH    141 - 210
LIQRKKVHVFGDELSLVTLFRCIQNMPETLPNNSCYSAGIAKLEEGDELQLAIPRENAQISLDGDVTFFG    211 - 280
ALKLL                                                                     281 - 285
//

Text Mined References (330)

PMID Year Title
27031098 2016 Reduced Number of Transitional and Naive B Cells in Addition to Decreased BAFF Levels in Response to the T Cell Independent Immunogen Pneumovax®23.
26950089 2016 Significance of BAFF/APRIL Expression and Their Receptors in Pediatric Patients With Acute Lymphoblastic Leukemia.
26914861 2016 Binding of B-cell maturation antigen to B-cell activating factor induces survival of multiple myeloma cells by activating Akt and JNK signaling pathways.
26901523 2016 Polymorphisms in B Cell Co-Stimulatory Genes Are Associated with IgG Antibody Responses against Blood-Stage Proteins of Plasmodium vivax.
26688003 2016 Blood and salivary-gland BAFF-driven B-cell hyperactivity is associated to rituximab inefficacy in primary Sjögren's syndrome.
26646413 2016 Comparative genomic analysis of eutherian tumor necrosis factor ligand genes.
26600308 2015 Changes in Blood B Cell-Activating Factor (BAFF) Levels in Multiple Sclerosis: A Sign of Treatment Outcome.
26590315 2016 The Expression of BAFF Is Controlled by IRF Transcription Factors.
26461968 2015 Longitudinal studies of a B cell-derived signature of tolerance in renal transplant recipients.
26424433 2015 Serum B cell-activating factor (BAFF) level in connective tissue disease associated interstitial lung disease.
26417991 2015 Synthetic Double-Stranded RNA Poly(I:C) Aggravates IgA Nephropathy by Triggering IgA Class Switching Recombination through the TLR3-BAFF Axis.
26359802 2015 CXCL13 and CCL11 Serum Levels and Lymphoma and Disease Activity in Primary Sjögren's Syndrome.
26339644 2015 B-Cell Activating Factor as a Cancer Biomarker and Its Implications in Cancer-Related Cachexia.
26327569 2015 Expression of BAFF-R, but not BAFF, is an independent prognostic factor in diffuse large B-cell lymphoma patients treated with R-CHOP.
26268376 2015 Polymorphisms in genes of the BAFF/APRIL system may constitute risk factors of B-CLL--a preliminary study on a Polish population.
26266827 2015 Role of B Cell-Activating Factor in Chronic Obstructive Pulmonary Disease.
26243624 2015 Serum BAFF and APRIL levels in patients with autoimmune hemolytic anemia and their clinical significance.
26214745 2015 B Cell Activating Factor (BAFF) and BAFF Receptor Expression in Autoimmune and Nonautoimmune Thyroid Diseases.
26198030 2015 The role of BAFF in the progression of rheumatoid arthritis.
26150532 2015 The B Cell-Stimulatory Cytokines BLyS and APRIL Are Elevated in Human Periodontitis and Are Required for B Cell-Dependent Bone Loss in Experimental Murine Periodontitis.
26073875 2015 B Cell-Activating Factor. An Orchestrator of Lymphoid Follicles in Severe Chronic Obstructive Pulmonary Disease.
25989238 2015 Differential Development of Systemic Lupus Erythematosus in NZM 2328 Mice Deficient in Discrete Pairs of BAFF Receptors.
25849069 2015 Cigarette smoke inhibits BAFF expression and mucosal immunoglobulin A responses in the lung during influenza virus infection.
25800158 2015 Association of BAFF -871C/T Promoter Polymorphism with Hepatitis C-Related Mixed Cryoglobulinemia in a Cohort of Egyptian Patients.
25759827 2014 Expression of TNF-?, APRIL and BCMA in Behcet's disease.
25723853 2015 B-cell activating factor in the pathophysiology of multiple myeloma: a target for therapy?
25656062 2015 The presence of B-cell activating factor (BAFF) in umbilical cord blood in both healthy and pre-eclamptic pregnancies and in human breast milk.
25637018 2015 HIV-1-triggered release of type I IFN by plasmacytoid dendritic cells induces BAFF production in monocytes.
25567522 2015 Serum soluble levels of the transmembrane activator and calcium-modulator and cyclophilin-ligand interactor in MPO-ANCA-associated renal vasculitis.
25360821 2014 MiR-30a-3p negatively regulates BAFF synthesis in systemic sclerosis and rheumatoid arthritis fibroblasts.
25339679 2014 Cytokine BAFF released by Helicobacter pylori-infected macrophages triggers the Th17 response in human chronic gastritis.
25162001 2014 Serum soluble TACI, a BLyS receptor, is a powerful prognostic marker of outcome in chronic lymphocytic leukemia.
25152030 The two mRNA transcription variants of the B-cell activating factor are differentially expressed, but in a stable ratio.
25085377 2015 The impact of TNF superfamily molecules on overall survival in acute myeloid leukaemia: correlation with biological and clinical features.
25033258 2015 Posttransplant soluble B-cell activating factor kinetics in pediatric recipients of first kidney allograft.
25002077 2014 IVIG regulates BAFF expression in patients with chronic inflammatory demyelinating polyneuropathy (CIDP).
24993857 2014 TLR9 and BAFF: their expression in patients with IgA nephropathy.
24931438 2014 B-cell-activating factor code and human cytomegalovirus infection in renal transplant recipients.
24906685 2014 The strength of the antibody response to the nematode Ascaris lumbricoides inversely correlates with levels of B-Cell Activating Factor (BAFF).
24889407 2014 Reduced tumour necrosis factor receptor superfamily 13C inversely correlated with tumour necrosis factor superfamily 13B in patients with immune thrombocytopenia.
24864436 2014 [Evaluation of dectin-1 and BAFF expression in conjunctival epithelial cells].
24847941 2014 The B lymphocyte differentiation factor (BAFF) is expressed in the airways of children with CF and in lungs of mice infected with Pseudomonas aeruginosa.
24811691 2014 Serum levels of B-cell activating factor in chronic hepatitis B virus infection: association with clinical diseases.
24809296 2014 Reduced BAFF-R and increased TACI expression in common variable immunodeficiency.
24802131 Sequential therapy with belimumab followed by rituximab in Sjögren's syndrome associated with B-cell lymphoproliferation and overexpression of BAFF: evidence for long-term efficacy.
24800836 2014 Chronic lymphocytic leukemia cells in a lymph node microenvironment depict molecular signature associated with an aggressive disease.
24780395 2014 Priming of Toll-like receptor 4 pathway in mesenchymal stem cells increases expression of B cell activating factor.
24758362 2014 B-cell activating factor detected on both naïve and memory B cells in bullous pemphigoid.
24728308 2014 B Lymphocyte Stimulator (BLyS) is expressed in human adipocytes in vivo and is related to obesity but not to insulin resistance.
24670802 2014 BAFF suppresses IL-15 expression in B cells.
24616478 2014 Metabolic reprogramming is required for antibody production that is suppressed in anergic but exaggerated in chronically BAFF-exposed B cells.
24602383 2014 Specific forms of BAFF favor BAFF receptor-mediated epithelial cell survival.
24534784 2014 Serum B-cell activating factor in myeloperoxiase-antineutrophil cytoplasmic antibodies-associated vasculitis.
24462743 2014 Post-transplantation B cell activating factor and B cell recovery before onset of chronic graft-versus-host disease.
24435807 2014 BAFF regulates activation of self-reactive T cells through B-cell dependent mechanisms and mediates protection in NOD mice.
24411564 2014 The function of BAFF on T helper cells in autoimmunity.
24393484 2014 Central role of interferon-beta in thymic events leading to myasthenia gravis.
24376672 2013 BAFF, APRIL, TWEAK, BCMA, TACI and Fn14 proteins are related to human glioma tumor grade: immunohistochemistry and public microarray data meta-analysis.
24289101 2013 B lymphocytes and B-cell activating factor promote collagen and profibrotic markers expression by dermal fibroblasts in systemic sclerosis.
24252051 2014 Increased serum concentration of BAFF/APRIL and IgA2 subclass in patients with mixed connective tissue disease complicated by interstitial lung disease.
24141333 2014 BAFF and APRIL as TNF superfamily molecules and angiogenesis parallel progression of human multiple myeloma.
24084099 2014 BAFF maintains T-cell survival by inducing OPN expression in B cells.
23940742 2013 Increased B cell-activating factor promotes tumor invasion and metastasis in human pancreatic cancer.
23936794 2013 Relationship between circulating BAFF serum levels with proliferating markers in patients with multiple myeloma.
23884224 2013 B-cell activating factor promoter polymorphisms in egyptian patients with systemic lupus erythematosus.
23846230 2013 Association of serum B cell activating factor from the tumour necrosis factor family (BAFF) and a proliferation-inducing ligand (APRIL) with central nervous system and renal disease in systemic lupus erythematosus.
23845207 2014 B-cell activating factor genetic variants in lymphomagenesis associated with primary Sjogren's syndrome.
23842189 2013 Elevated pretransplantation soluble BAFF is associated with an increased risk of acute antibody-mediated rejection.
23773925 2013 B-cell activating factor (BAFF) is elevated in chronic granulomatous disease.
23768867 2013 Evaluation of TNF superfamily molecules in multiple myeloma patients: correlation with biological and clinical features.
23686487 2013 SOCS3 regulates BAFF in human enterocytes under ribosomal stress.
23685362 2013 Elevated serum BAFF levels in patients with sarcoidosis: association with disease activity.
23684916 2013 B cell activating factor-dependent expression of vascular endothelial growth factor in MH7A human synoviocytes stimulated with tumor necrosis factor-?.
23639027 2013 Serum B-cell activating factor assessment in a population of Egyptian patients with systemic sclerosis.
23620746 2013 No evidence that soluble TACI induces signalling via membrane-expressed BAFF and APRIL in myeloid cells.
23604864 2013 No evidence for association of the CD40, CD40L and BLYS polymorphisms, B-cell co-stimulatory molecules, with Brazilian endemic Plasmodium vivax malaria.
23557796 2013 hsBAFF promotes proliferation and survival in cultured B lymphocytes via calcium signaling activation of mTOR pathway.
23436580 2013 Toll-like receptor 9 activation induces expression of membrane-bound B-cell activating factor (BAFF) on human B cells and leads to increased proliferation in response to both soluble and membrane-bound BAFF.
23342125 2013 B cell activating factor of the tumor necrosis factor family (BAFF) behaves as an acute phase reactant in acute pancreatitis.
23336587 2013 The effect of BLyS on the activity of peripheral B lymphocytes mediated by BLyS receptors in patients with systemic lupus erythematosus.
23324534 2013 BAFF/APRIL system in pediatric OMS: relation to severity, neuroinflammation, and immunotherapy.
23322463 2013 BAFF expression correlates with idiopathic inflammatory myopathy disease activity measures and autoantibodies.
23317407 2013 Serum BAFF and APRIL might be associated with disease activity and kidney damage in patients with anti-glomerular basement membrane disease.
23303823 2013 CD19(+)CD21(low) B cells and patients at risk for NIH-defined chronic graft-versus-host disease with bronchiolitis obliterans syndrome.
23276925 2013 BlyS: a potential hallmark of multiple myeloma.
23272079 2012 Expression of BAFF and BAFF-R in follicular lymphoma: correlation with clinicopathologic characteristics and survival outcomes.
23271704 2013 Induction of BAFF expression by IFN-? via JAK/STAT signaling pathways in human intestinal epithelial cells.
23264555 2013 Association between -871C>T promoter polymorphism in the B-cell activating factor gene and the response to rituximab in rheumatoid arthritis patients.
23088438 2013 B-cell maturation antigen, a proliferation-inducing ligand, and B-cell activating factor are candidate mediators of spinal cord injury-induced autoimmunity.
23039894 2012 B cell activating factor (BAFF) in the natural history of chronic hepatitis C virus liver disease and mixed cryoglobulinaemia.
22927996 2012 Active chronic sarcoidosis is characterized by increased transitional blood B cells, increased IL-10-producing regulatory B cells and high BAFF levels.
22898048 2012 BAFF induces spleen CD4+ T cell proliferation by down-regulating phosphorylation of FOXO3A and activates cyclin D2 and D3 expression.
22896003 2012 B cells from patients with chronic GVHD are activated and primed for survival via BAFF-mediated pathways.
22883025 2012 BAFF and BAFF-R levels are associated with risk of long-term kidney graft dysfunction and development of donor-specific antibodies.
22879463 2013 BLyS upregulation in Sjogren's syndrome associated with lymphoproliferative disorders, higher ESSDAI score and B-cell clonal expansion in the salivary glands.
22851468 2013 Serum levels of BAFF, but not APRIL, are increased after rituximab treatment in patients with primary Sjogren's syndrome: data from a placebo-controlled clinical trial.
22850273 2012 BLyS expression and JNK activation may form a feedback loop to promote survival and proliferation of multiple myeloma cells.
22822003 2012 Further examination of BAFF SNPs in cGVHD.
22752534 2013 Serum level of APRIL/BLyS in Behçet's disease patients: clinical significance in uveitis and disease activity.
22749832 2012 The complexity of the BAFF TNF-family members: implications for autoimmunity.
22736090 2013 Prevalence of interferon type I signature in CD14 monocytes of patients with Sjogren's syndrome and association with disease activity and BAFF gene expression.
22728080 2012 Genetic variation in B cell-activating factor of the TNF family (BAFF) and asthma exacerbations among African American subjects.
22719887 2012 Increased levels of BAFF and APRIL related to human active pulmonary tuberculosis.
22718279 2012 Human decidual stromal cells secrete C-X-C motif chemokine 13, express B cell-activating factor and rescue B lymphocytes from apoptosis: distinctive characteristics of follicular dendritic cells.
22593611 2012 Stromal endothelial cells establish a bidirectional crosstalk with chronic lymphocytic leukemia cells through the TNF-related factors BAFF, APRIL, and CD40L.
22575417 2012 The expression of BAFF in the muscles of patients with dermatomyositis.
22537850 2012 Protein kinase C stimulates human B cell activating factor gene expression through reactive oxygen species-dependent c-Fos in THP-1 pro-monocytic cells.
22531553 2012 Serum BAFF and APRIL levels in patients with IgG4-related disease and their clinical significance.
22526370 2012 B cell-activating factor: its clinical significance in multiple myeloma patients.
22516957 2012 Fc?RIIb and BAFF differentially regulate peritoneal B1 cell survival.
22498341 2012 Serum BAFF levels are related to angiogenesis and prognosis in patients with multiple myeloma.
22463935 2012 BlyS is up-regulated by hypoxia and promotes migration of human breast cancer cells.
22399512 2012 Serum BAFF concentrations in patients with Graves' disease and orbitopathy before and after immunosuppressive therapy.
22340436 2012 Elevated BAFF levels in the cerebrospinal fluid of patients with neuro-Behçet's disease: BAFF is correlated with progressive dementia and psychosis.
22338013 2012 Cytokine BAFF gene variation is associated with survival of patients with T-cell lymphomas.
22325420 A novel modality of BAFF-specific inhibitor AMG623 peptibody reduces B-cell number and improves outcomes in murine models of autoimmune disease.
22169295 2011 [Effect of BAFF/APRIL mRNA expression induced by glucocorticoid and bortezomib in multiple myeloma cells in vitro].
22124120 2012 Soluble BAFF levels inversely correlate with peripheral B cell numbers and the expression of BAFF receptors.
22102726 2011 BAFF/APRIL inhibition decreases selection of naive but not antigen-induced autoreactive B cells in murine systemic lupus erythematosus.
22059379 2012 APRIL and BAFF proteins increase proliferation of human adipose-derived stem cells through activation of Erk1/2 MAP kinase.
22018243 2011 Regulatory mechanisms for the production of BAFF and IL-6 are impaired in monocytes of patients of primary Sjögren's syndrome.
21889147 2011 Proprotein convertases in human atherosclerotic plaques: the overexpression of FURIN and its substrate cytokines BAFF and APRIL.
21883351 2011 Promoter -817C>T variant of B lymphocyte stimulator gene (BLyS) and susceptibility to endometriosis-related infertility and idiopathic infertility in Brazilian population.
21849293 2011 The plasma concentration of the B cell activating factor is increased in children with acute malaria.
21790703 2011 Elevated serum BAFF levels in patients with autoimmunity and lymphoproliferation.
21765951 2011 The expression of BAFF, APRIL and TWEAK is altered in eczema skin but not in the circulation of atopic and seborrheic eczema patients.
21747319 2011 Clinical significance of B cell-activating factor in autoimmune pancreatitis.
21733733 2012 Elevated BAFF (BLyS) and APRIL in Juvenile idiopathic arthritis patients: relation to clinical manifestations and disease activity.
21707303 2011 Combined analysis of levels of serum B-cell activating factor and a proliferation-inducing ligand as predictor of disease progression in patients with chronic lymphocytic leukemia.
21632709 2011 Cellular competition independent of BAFF/B lymphocyte stimulator results in low frequency of an autoreactive clonotype in mature polyclonal B cell compartments.
21628416 2011 Genetic variation in recipient B-cell activating factor modulates phenotype of GVHD.
21559937 2011 BAFF serum levels in myasthenia gravis: effects of therapy.
21557212 2011 Synovial fibroblasts promote immunoglobulin class switching by a mechanism involving BAFF.
21538321 2011 Genetic determinants in hepatitis C virus-associated mixed cryoglobulinemia: role of polymorphic variants of BAFF promoter and Fc? receptors.
21537154 2011 B cell activating factor gene polymorphisms in patients with risk of idiopathic thrombocytopenic purpura.
21518495 2011 [Expression and significance of B cell-activating factor of TNF family (BAFF) and B cell lymphoma/leukemia-2 (BCL-2) in multiple myeloma].
21505913 2011 BAFF and APRIL induce inflammatory activation of THP-1 cells through interaction with their conventional receptors and activation of MAPK and NF-?B.
21483105 2011 Detection of the TNFSF members BAFF, APRIL, TWEAK and their receptors in normal kidney and renal cell carcinomas.
21372118 2011 Multiple sclerosis: BAFF and CXCL13 in cerebrospinal fluid.
21293157 2011 Serum levels of BAFF and APRIL in myeloperoxidase anti-neutrophil cytoplasmic autoantibody-associated renal vasculitis: association with disease activity.
21239754 2011 Increased expression of B cell activation factor supports the abnormal expansion of transitional B cells in systemic lupus erythematosus.
21211990 2011 Chemokine/cytokine profiling after rituximab: reciprocal expression of BCA-1/CXCL13 and BAFF in childhood OMS.
21177756 2011 Interferon-beta increases systemic BAFF levels in multiple sclerosis without increasing autoantibody production.
21145253 2011 hsBAFF regulates proliferation and response in cultured CD4(+) T lymphocytes by upregulation of intracellular free Ca(2+) homeostasis.
21051868 2011 Induction of B cell-activating factor by viral infection is a general phenomenon, but the types of viruses and mechanisms depend on cell type.
21039888 2011 TLR7 regulates dendritic cell-dependent B-cell responses through BlyS in immune thrombocytopenic purpura.
20974656 2010 Expressions of BAFF/BAFF receptors and their correlation with disease activity in Chinese SLE patients.
20956327 2010 B-cell activating factor and v-Myc myelocytomatosis viral oncogene homolog (c-Myc) influence progression of chronic lymphocytic leukemia.
20935029 2010 Preferential increase of B-cell activating factor in the cerebrospinal fluid of neuromyelitis optica in a white population.
20927378 2010 Genetic and molecular functional characterization of variants within TNFSF13B, a positional candidate preeclampsia susceptibility gene on 13q.
20890272 2011 Intrarenal production of B-cell survival factors in human lupus nephritis.
20870901 2011 High expression levels of B lymphocyte stimulator (BLyS) by dendritic cells correlate with HIV-related B-cell disease progression in humans.
20813000 2010 Polymorphisms in DNA repair genes and risk of non-Hodgkin lymphoma in a pooled analysis of three studies.
20802378 2010 A multiplex MALDI-TOF MS approach facilitates genotyping of DNA from formalin-fixed paraffin-embedded tumour specimens.
20646006 2010 Immune receptor expressed on myeloid cells 1 (IREM-1) inhibits B cell activation factor (BAFF)-mediated inflammatory regulation of THP-1 cells through modulation of the activities of extracellular regulated kinase (ERK).
20568250 2010 Common single nucleotide polymorphisms in immunoregulatory genes and multiple myeloma risk among women in Connecticut.
20561430 2010 [Significance of B cell activating factor of TNF family promoter polymorphisms in patients with immune thrombocytopenic purpura].
20546021 2010 Baff serum level predicts time to first treatment in early chronic lymphocytic leukemia.
20428981 2010 Differential effects of BAFF on B cell precursor acute lymphoblastic leukemia and Burkitt lymphoma.
20357250 2010 TLR4 promotes B cell maturation: independence and cooperation with B lymphocyte-activating factor.
20302641 2010 B-lymphocyte stimulator/a proliferation-inducing ligand heterotrimers are elevated in the sera of patients with autoimmune disease and are neutralized by atacicept and B-cell maturation antigen-immunoglobulin.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20089415 2010 Poly(I:C) induces BLyS-expression of airway fibroblasts through phosphatidylinositol 3-kinase.
20004378 2010 B lymphocyte stimulator -817C>T promoter polymorphism and the predisposition for the development of deep infiltrating endometriosis.
19935379 2009 BAFF may modulate the rate of B-cell repopulation after rituximab therapy for acute renal transplant rejection.
19909733 2010 BLyS and APRIL expression in peripheral blood mononuclear cells of cryptococcal meningitis patients and their clinical significance.
19877053 2009 B lymphocyte stimulator expression in pediatric systemic lupus erythematosus and juvenile idiopathic arthritis patients.
19863844 2009 BAFF from bone marrow-derived mesenchymal stromal cells of rheumatoid arthritis patients improves their B-cell viability-supporting properties.
19841639 2010 Reverse signaling through BAFF differentially regulates the expression of inflammatory mediators and cytoskeletal movements in THP-1 cells.
19840904 2010 Serum BAFF and APRIL levels in patients with PBC.
19828625 2009 Adipocytes as immune cells: differential expression of TWEAK, BAFF, and APRIL and their receptors (Fn14, BAFF-R, TACI, and BCMA) at different stages of normal and pathological adipose tissue development.
19794139 2009 The effects of BAFF and BAFF-R-Fc fusion protein in immune thrombocytopenia.
19774453 2010 Elevated production of B cell chemokine CXCL13 is correlated with systemic lupus erythematosus disease activity.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19758161 2009 B-lymphocyte stimulator and a proliferation-inducing ligand serum levels in IgA-deficient patients with and without celiac disease.
19731825 2009 [Expression of B lymphocyte stimulator and its receptors in multiple myeloma cells: a mechanism for the cell growth and survival].
19604268 2009 Association between total immunoglobulin E and antibody responses to naturally acquired Ascaris lumbricoides infection and polymorphisms of immune system-related LIG4, TNFSF13B and IRS2 genes.
19565488 2009 Systemic activation of the immune system induces aberrant BAFF and APRIL expression in B cells in patients with systemic lupus erythematosus.
19545677 2009 Abnormal high expression of B-cell activating factor belonging to the TNF superfamily (BAFF) associated with long-term outcome in kidney transplant recipients.
19499314 2009 High-dose dexamethasone inhibits BAFF expression in patients with immune thrombocytopenia.
19439611 2009 Identification of BLyS (B lymphocyte stimulator), a non-myelin-associated protein, as a functional ligand for Nogo-66 receptor.
19421221 2009 Individual and epistatic effects of genetic polymorphisms of B-cell co-stimulatory molecules on susceptibility to pemphigus foliaceus.
19395025 2009 BAFF and APRIL expression in B-cell chronic lymphocytic leukemia: correlation with biological and clinical features.
19393234 2009 Interleukin-10 and interferon-gamma up-regulate the expression of B-cell activating factor in cultured human promyelocytic leukemia cells.
19383901 2009 Genetic variation in B-cell-activating factor is associated with an increased risk of developing B-cell non-Hodgkin lymphoma.
19366834 2009 The lack of epithelial interleukin-7 and BAFF/BLyS gene expression in prostate cancer as a possible mechanism of tumor escape from immunosurveillance.
19339060 2009 Elevated B-cell activating factor BAFF, but not APRIL, correlates with CSF cerebellar autoantibodies in pediatric opsoclonus-myoclonus syndrome.
19291294 2009 APRIL is overexpressed in cancer: link with tumor progression.
19249491 The expression of B-cell activating factor belonging to tumor necrosis factor superfamily (BAFF) significantly correlated with C4D in kidney allograft rejection.
19190830 2009 Elevation of B cell-activating factor belonging to the tumour necrosis factor [corrected] family (BAFF) in haemophilia A patients with inhibitor.
19187273 2009 B-Lymphocyte stimulator: a new biomarker for multiple myeloma.
19175985 2008 [Expression and significance of BLyS/April in patients with acute idiopathic thrombocytopenic purpura].
19168788 2009 Altered B-cell homeostasis and excess BAFF in human chronic graft-versus-host disease.
19135236 2009 Local release of B cell-activating factor of the TNF family after segmental allergen challenge of allergic subjects.
19124722 2009 Increased CD4+Foxp3+ T cells in BAFF-transgenic mice suppress T cell effector responses.
19118513 2008 The abnormal high expression of B cell activating factor belonging to TNF superfamily (BAFF) and its potential role in kidney transplant recipients.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
19051265 2009 Serum BLyS levels increase after rituximab as initial therapy in patients with follicular Grade 1 non-Hodgkin lymphoma.
19028483 2009 Correlation of expression levels of BLyS and its receptors with multiple myeloma.
19026118 Serum BAFF levels and skin mRNA expression in patients with Behçet's disease.
19005881 2009 BAFF and BAFF-R of peripheral blood and spleen mononuclear cells in idiopathic thrombocytopenic purpura.
18988879 2008 Can BAFF promoter polymorphism be a predisposing condition for HCV-related mixed cryoglobulinemia?
18852352 2008 A potential role for B-cell activating factor in the pathogenesis of autoimmune myasthenia gravis.
18843286 2009 Lymphoma cell adhesion-induced expression of B cell-activating factor of the TNF family in bone marrow stromal cells protects non-Hodgkin's B lymphoma cells from apoptosis.
18784835 2008 Human BLyS facilitates engraftment of human PBL derived B cells in immunodeficient mice.
18775026 2008 Aberrant expression of BAFF receptor, a member of the tumor necrosis factor receptor family, in malignant cells of nonhematopoietic origins.
18718031 2008 Raised intrathecal levels of APRIL and BAFF in patients with systemic lupus erythematosus: relationship to neuropsychiatric symptoms.
18715196 2008 BAFF is a biological response marker to IFN-beta treatment in multiple sclerosis.
18687360 2008 hsBAFF enhances activity of NK cells by regulation of CD4(+) T lymphocyte function.
18668552 2008 Association of plasma B lymphocyte stimulator levels and disease activity in systemic lupus erythematosus.
18641361 2008 Excessive production of IFN-gamma in patients with systemic lupus erythematosus and its contribution to induction of B lymphocyte stimulator/B cell-activating factor/TNF ligand superfamily-13B.
18637712 2009 hsBAFF-upregulated intracellular free Ca(2+) homeostasis regulates ERK1/2 activity and cell proliferation in B cells in vitro.
18628489 2008 Overexpression of B cell-activating factor of TNF family (BAFF) is associated with Helicobacter pylori-independent growth of gastric diffuse large B-cell lymphoma with histologic evidence of MALT lymphoma.
18625509 2008 A novel bioassay for B-cell activating factor (BAFF) based on expression of a BAFF-receptor ectodomain-tumour necrosis factor-related apoptosis-inducing ligand (TRAIL) receptor-2 endodomain fusion receptor in human rhabdomyosarcoma cells.
18617551 2008 Polymorphism in the 5' regulatory region of the B-lymphocyte activating factor gene is associated with the Ro/La autoantibody response and serum BAFF levels in primary Sjogren's syndrome.
18606652 2008 Immune opsonins modulate BLyS/BAFF release in a receptor-specific fashion.
18586330 2008 Serum BAFF expression in patients with myasthenia gravis.
18566393 2008 Viral double-stranded RNA triggers Ig class switching by activating upper respiratory mucosa B cells through an innate TLR3 pathway involving BAFF.
18556064 2009 Increased serum BAFF (B-cell activating factor of the TNF family) level is a peculiar feature associated with familial chronic lymphocytic leukemia.
18551073 2008 B cell survival in intragraft tertiary lymphoid organs after rituximab therapy.
18528969 2008 Concentrations of BAFF correlate with autoantibody levels, clinical disease activity, and response to treatment in early rheumatoid arthritis.
18490739 2008 B lymphocyte stimulator regulates adaptive immune responses by directly promoting dendritic cell maturation.
18410958 2008 Evidence of a role for B cell-activating factor of the TNF family in the pathogenesis of chronic rhinosinusitis with nasal polyps.
18403603 2008 Signaling pathways for B cell-activating factor (BAFF) and a proliferation-inducing ligand (APRIL) in human placenta.
18366696 2008 Expression of TNF-superfamily members BAFF and APRIL in breast cancer: immunohistochemical study in 52 invasive ductal breast carcinomas.
18350548 2008 Viruses induce high expression of BAFF by salivary gland epithelial cells through TLR- and type-I IFN-dependent and -independent pathways.
18328673 2008 Serum BAFF and APRIL levels in patients with alopecia areata.
18249037 2008 Increase in B-cell-activation factor (BAFF) and IFN-gamma productions by tonsillar mononuclear cells stimulated with deoxycytidyl-deoxyguanosine oligodeoxynucleotides (CpG-ODN) in patients with IgA nephropathy.
18243342 2008 Integration of signals mediated by B-cell receptor, B-cell activating factor of the tumor necrosis factor family (BAFF) and Fas (CD95).
18204790 2008 Age-related changes in BAFF and APRIL profiles and upregulation of BAFF and APRIL expression in patients with primary antibody deficiency.
18174230 2008 Association of polymorphisms in complement component C3 gene with susceptibility to systemic lupus erythematosus.
18172003 2008 BAFF enhances chemotaxis of primary human B cells: a particular synergy between BAFF and CXCL13 on memory B cells.
18064389 2007 Abnormally high expression of BAFF on T lymphocytes from lung cancer-associated pleural effusions and its potent anti-tumor effect.
18050196 2007 Augmented interferon-alpha pathway activation in patients with Sjögren's syndrome treated with etanercept.
17988587 2007 [Changes of serum BAFF and IL-21 levels in patients with systemic lupus erythematosus and their clinical significance].
17963166 Expression of BAFF and BAFF-R in the synovial tissue of patients with rheumatoid arthritis.
17947475 2007 High levels of B-cell activating factor in patients with active chronic graft-versus-host disease.
17942754 2008 TACI, unlike BAFF-R, is solely activated by oligomeric BAFF and APRIL to support survival of activated B cells and plasmablasts.
17908986 2007 Neutralizing B-cell activating factor antibody improves survival and inhibits osteoclastogenesis in a severe combined immunodeficient human multiple myeloma model.
17907168 2007 BAFF synthesis by rheumatoid synoviocytes is positively controlled by alpha5beta1 integrin stimulation and is negatively regulated by tumor necrosis factor alpha and Toll-like receptor ligands.
17896803 2007 Elevated serum APRIL levels in patients with systemic sclerosis: distinct profiles of systemic sclerosis categorized by APRIL and BAFF.
17825416 2008 Identification of new splice variants of the genes BAFF and BCMA.
17640886 2007 Human endometriosis is associated with plasma cells and overexpression of B lymphocyte stimulator.
17592744 2008 BAFF - an essential survival factor for B cells: Links to genesis of ITP and may be of therapeutic target.
17584580 2007 Elevated serum BAFF levels in patients with autoimmune hepatitis.
17556024 2007 High serum levels of BAFF, APRIL, and TACI in common variable immunodeficiency.
17530706 2007 Tumor necrosis factor alpha activates release of B lymphocyte stimulator by neutrophils infiltrating the rheumatoid joint.
17499850 2007 cDNA cloning, expression and bioactivity of porcine BAFF.
17469105 2007 BAFF-modulated repopulation of B lymphocytes in the blood and salivary glands of rituximab-treated patients with Sjögren's syndrome.
17442944 2007 Divergent effects of BAFF on human memory B cell differentiation into Ig-secreting cells.
17393290 2007 BAFF, a new target for intravenous immunoglobulin in autoimmunity and cancer.
17346422 BAFF and rheumatic autoimmune disorders: implications for disease management and therapy.
17296586 2007 Prognostic significance of serum B-lymphocyte stimulator in Hodgkin's lymphoma.
17257595 2007 sBAFF mutants induce neutralizing antibodies against BAFF.
17119117 2007 The growth factor fusion construct containing B-lymphocyte stimulator (BLyS) and the toxin rGel induces apoptosis specifically in BAFF-R-positive CLL cells.
16931039 2006 The role of the BAFF/APRIL system on T cell function.
16931038 2006 Impact of the BAFF/BR3 axis on B cell survival, germinal center maintenance and antibody production.
16931037 2006 BLyS and B cell homeostasis.
16919470 2006 BLyS receptor signatures resolve homeostatically independent compartments among naïve and antigen-experienced B cells.
16916610 2006 BAFF, APRIL and human B cell disorders.
16916609 2006 Regulation of B cell self-tolerance by BAFF.
16914324 2006 BAFF, APRIL and their receptors: structure, function and signaling.
16863659 2006 Targeting BAFF: immunomodulation for autoimmune diseases and lymphomas.
16840730 2006 Synthetic anti-BR3 antibodies that mimic BAFF binding and target both human and murine B cells.
16838132 2006 Mutational analysis of human BLyS in patients with common variable immunodeficiency.
16825497 2006 A role for BLyS in the activation of innate immune cells.
16818641 2006 Role of B-cell-activating factor in adhesion and growth of human multiple myeloma cells in the bone marrow microenvironment.
16802367 2006 Identification of transitional type II B cells in the salivary glands of patients with Sjögren's syndrome.
16740602 2006 Aberrant expression of BAFF in T cells of systemic lupus erythematosus, which is recapitulated by a human T cell line, Loucy.
16623930 2006 The reduction of serum B-lymphocyte activating factor levels following quinacrine add-on therapy in systemic lupus erythematosus.
16604261 2006 Two observed regions in B lymphocyte stimulator important for its biological activity.
16547227 2006 HIV-1 envelope triggers polyclonal Ig class switch recombination through a CD40-independent mechanism involving BAFF and C-type lectin receptors.
16507129 2006 No evidence for an association between the -871 T/C promoter polymorphism in the B-cell-activating factor gene and primary Sjögren's syndrome.
16497967 2006 Constitutive NF-kappaB and NFAT activation leads to stimulation of the BLyS survival pathway in aggressive B-cell lymphomas.
16475789 2006 Formation of virus-like clusters is an intrinsic property of the tumor necrosis factor family member BAFF (B cell activating factor).
16356193 2006 B lymphocyte stimulator (BLyS) isoforms in systemic lupus erythematosus: disease activity correlates better with blood leukocyte BLyS mRNA levels than with plasma BLyS protein levels.
16304043 2006 B-lymphocyte stimulator (BLyS) stimulates immunoglobulin production and malignant B-cell growth in Waldenstrom macroglobulinemia.
16301744 2005 BAFF regulates B cell survival by downregulating the BH3-only family member Bim via the ERK pathway.
16242914 2005 BAFF is elevated in serum of patients with Wegener's granulomatosis.
16239971 2005 BLyS and APRIL in rheumatoid arthritis.
16052575 2005 Is periodontal disease mediated by salivary BAFF in Sjögren's syndrome?
15981083 2005 Association between circulating levels of the novel TNF family members APRIL and BAFF and lymphoid organization in primary Sjögren's syndrome.
15860672 2005 Nurselike cells express BAFF and APRIL, which can promote survival of chronic lymphocytic leukemia cells via a paracrine pathway distinct from that of SDF-1alpha.
15843552 2005 BAFF augments certain Th1-associated inflammatory responses.
15827134 2005 The level of TACI gene expression in myeloma cells is associated with a signature of microenvironment dependence versus a plasmablastic signature.
15728515 2005 Enhanced apoptotic cell clearance capacity and B cell survival factor production by IL-10-activated macrophages: implications for Burkitt's lymphoma.
15634908 2005 Fibroblast-like synoviocytes of mesenchymal origin express functional B cell-activating factor of the TNF family in response to proinflammatory cytokines.
15542592 2005 Structures of APRIL-receptor complexes: like BCMA, TACI employs only a single cysteine-rich domain for high affinity ligand binding.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15470519 [B lymphocyte stimulator (BLyS) and monocytes: possible role in autoimmune diseases with a particular reference to rheumatoid arthritis].
15358625 2005 Proinflammatory mediators elicit secretion of the intracellular B-lymphocyte stimulator pool (BLyS) that is stored in activated neutrophils: implications for inflammatory diseases.
15251985 2004 Expression of BLyS and its receptors in B-cell non-Hodgkin lymphoma: correlation with disease activity and patient outcome.
15230285 2004 A therapeutic role for BLyS antagonists.
15070697 2004 BAFF and APRIL protect myeloma cells from apoptosis induced by interleukin 6 deprivation and dexamethasone.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14978135 2004 Lymphoma B cells evade apoptosis through the TNF family members BAFF/BLyS and APRIL.
14673998 2003 B lymphocyte stimulator overexpression in patients with systemic lupus erythematosus: longitudinal observations.
14630796 2004 BAFF/BLyS can potentiate B-cell selection with the B-cell coreceptor complex.
14607922 2003 EBV-encoded latent membrane protein 1 cooperates with BAFF/BLyS and APRIL to induce T cell-independent Ig heavy chain class switching.
14504101 2004 Involvement of BAFF and APRIL in the resistance to apoptosis of B-CLL through an autocrine pathway.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12867412 2003 DeltaBAFF, an alternate splice isoform that regulates receptor binding and biopresentation of the B cell survival cytokine, BAFF.
12865416 2003 BAFF selectively enhances the survival of plasmablasts generated from human memory B cells.
12755599 2003 BAFF/BLyS receptor 3 comprises a minimal TNF receptor-like module that encodes a highly focused ligand-binding site.
12721620 2003 Ligand-receptor binding revealed by the TNF family member TALL-1.
12715002 2003 Crystal structure of the BAFF-BAFF-R complex and its implications for receptor activation.
12531790 2003 Macrophage- and dendritic cell--dependent regulation of human B-cell proliferation requires the TNF family ligand BAFF.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12424625 2002 Analysis on the association of human BLYS (BAFF, TNFSF13B) polymorphisms with systemic lupus erythematosus and rheumatoid arthritis.
12408045 2003 BLyS and B cell autoimmunity.
12389615 2002 B lymphocyte stimulator (BLyS): a therapeutic trichotomy for the treatment of B lymphocyte diseases.
12370363 2002 BLyS and APRIL form biologically active heterotrimers that are expressed in patients with systemic immune-based rheumatic diseases.
12351410 2002 Aberrant expression of B-lymphocyte stimulator by B chronic lymphocytic leukemia cells: a mechanism for survival.
12154359 2002 DCs induce CD40-independent immunoglobulin class switching through BLyS and APRIL.
12149433 2002 Identification of downstream genes up-regulated by the tumor necrosis factor family member TALL-1.
11862220 2002 Structural basis of BLyS receptor recognition.
11853672 2002 Crystal structure of sTALL-1 reveals a virus-like assembly of TNF family ligands.
11827482 2002 Crystal structure of extracellular human BAFF, a TNF family member that stimulates B lymphocytes.
11509692 2001 BAFF-R, a newly identified TNF receptor that specifically interacts with BAFF.
11509691 2001 An essential role for BAFF in the normal development of B cells through a BCMA-independent pathway.
10973284 2000 APRIL and TALL-I and receptors BCMA and TACI: system for regulating humoral immunity.
10956646 2000 Tumor necrosis factor (TNF) receptor superfamily member TACI is a high affinity receptor for TNF family members APRIL and BLyS.
10908663 2000 B cell maturation protein is a receptor for the tumor necrosis factor family member TALL-1.
10880535 2000 TACI is a TRAF-interacting receptor for TALL-1, a tumor necrosis factor family member involved in B cell regulation.
10801128 2000 TACI and BCMA are receptors for a TNF homologue implicated in B-cell autoimmune disease.
10661873 1999 Characterization of a new member of the TNF family expressed on antigen presenting cells.
10398604 1999 BLyS: member of the tumor necrosis factor family and B lymphocyte stimulator.
10359578 1999 BAFF, a novel ligand of the tumor necrosis factor family, stimulates B cell growth.
10347144 1999 Identification and characterization of a novel cytokine, THANK, a TNF homologue that activates apoptosis, nuclear factor-kappaB, and c-Jun NH2-terminal kinase.
10331498 1999 TALL-1 is a novel member of the TNF family that is down-regulated by mitogens.