Property Summary

NCBI Gene PubMed Count 54
PubMed Score 1848.40
PubTator Score 889.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
psoriasis -1.300 4.2e-04
cutaneous lupus erythematosus -1.500 2.5e-03
osteosarcoma 1.303 6.5e-06
glioblastoma -1.500 1.5e-02
medulloblastoma, large-cell -2.100 1.9e-02
tuberculosis -1.300 3.4e-04
pancreatic ductal adenocarcinoma liver m... 1.082 2.8e-02
lung cancer 1.600 2.7e-02
breast carcinoma -1.100 4.3e-04
pediatric high grade glioma -1.200 1.6e-02
pilocytic astrocytoma -1.400 3.8e-03
lung adenocarcinoma 1.200 1.0e-03
Pick disease -2.000 2.9e-06

 CSPA Cell Line (1)

Gene RIF (36)

PMID Text
26810853 Biologics beyond TNF-alpha inhibitors and the effect of targeting the homologues TL1A-DR3 pathway in chronic inflammatory disorders.
26509650 DR3 is efficiently activated by soluble TL1A trimers.
26393680 Higher DR3 levels were associated with early stage chronic lymphocytic leukemia.
26065008 These data identify new roles for DR3 in regulating OB-dependent bone mineral apposition.
26046454 DR3 is expressed by IL-22-producing human group 3 innate lymphoid cells (ILC3s).
25929035 The changes in frequency of occurrence of spliced variants of DR3/LARD mRNA were directed towards modulation of apoptosis and restraint of antiviral immune response.
25509355 Distinctions in occurrence of spectrums of DR3/LARD mRNA at healthy volunteers and colon cancer patients can define a different susceptibility of immunocompetent and tumor cells for apoptosis
25399326 DR3 is expressed in some interstitial vascular endothelial cells in human kidney in situ. These EC also respond to TL1A by activating NF-kappaB. Very low levels of DR3 are seen on the cell surface of HUVEC, which do not respond to TL1A.
25370568 Silencing of the DR3 gene affect levels of apoptosis antigen3 ligand in cells.
25269704 Human memory IL-18Ralpha and DR3 CD4+ T cells may contribute to antigen-independent innate responses at barrier surfaces.
25083589 Suggest tectochrysin leads to apoptotic cell death in NSCLC cells through activation of DR3 and Fas expression via inhibition of STAT3 phosphorylation.
25044706 DR-3 drives early cartilage destruction in the antigen-induced model of inflammatory arthritis through the release of CXCL1, maximizing neutrophil recruitment to the joint and leading to enhanced local production of cartilage-destroying enzymes.
24832108 These results suggested that TL1A could promote Th17 differentiation in rheumatoid arthritis via the activation of RORc, and this effect may be mediated by the binding of TL1A with DR3.
23658110 TRAMP mice fed with 3'-diindolylmethane-supplemented diet show much lower incidence of tumorigenesis and metastasis than the untreated control group.
23443464 Collectively, these data suggest a complex role for DR3 in breast cancer development and progression
22956587 Both TNFRSF25 and TNFRSF4 independently and additively costimulate vaccine-induced CD8+ T cell proliferation following both primary and secondary antigen challenge.
22641456 Protein expression of tumour necrosis factor (TNF)-like ligand 1A (TL1A) and death-domain receptor (DR)3 is upregulated in the aged bladder tissues.
22043900 It was shown that IL-32 enhanced the cytotoxic effect of natural killer cells on protate cancer cells through activation of DR3 and caspase-3.
21722370 Investigated further the mechanisms by which the E-selectin-activated pathways downstream of DR3 confer a survival advantage to colon cancer cells.
21672030 in active psoriasis, we observed abundant immunostaining for TL1A and significant upregulation of its receptors DR3 and DcR3
21153333 role of TNFRSF25:TNFSF15 in disease and health
20568250 Observational study of gene-disease association. (HuGE Navigator)
20125169 critically involved in the pathogenesis of rheumatoid arthritis
19773279 Observational study of gene-disease association. (HuGE Navigator)
19674013 HLA-B8 and DR3 haplotype is associated with graft failure after renal transplantation in patients with underlying immunoglobulin A nephropathy
18411341 TNFR25/TL1A pair provides an early signal for cytokine production in the lung, and therefore may be a drug target in attempts to attenuate lung inflammation in asthmatics.
17085968 These results suggest that caspase-10, DR-3 and IGFBP-3 are involved in apoptosis in the preeclamptic placenta.
16986165 Results suggest that death receptor-3 activation can mediate apoptosis in osteoblasts, although its activity is highly restricted by its soluble ligand-binding isoform and possibly also by alternate survival signals.
16517446 VEGI gene expression is subject to regulation by inflammatory cytokines. VEGI is also able to regulate the expression of several important genes involved in angiogenesis.
15760679 TL1A and DR3 is involved in atherosclerosis via the induction of pro-inflammatory cytokines/chemokines
15301860 Observational study of genotype prevalence. (HuGE Navigator)
15241467 Death receptor 3 gene duplication is associated with rheumatoid arthritis
12882979 TL1A-induced NF-kappaB activation and c-IAP2 production prevent DR3-mediated apoptosis
12875962 These data confirm that silencer of death domains (SODD) and death receptor 3 (DR3) are expressed in a regulated manner during renal transplant rejection, and identify DR3 as a potential inducible mediator of tubular inflammation and injury.
11819535 Observational study of gene-disease association. (HuGE Navigator)
11793848 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEQRPRGCAAVAAALLLVLLGARAQGGTRSPRCDCAGDFHKKIGLFCCRGCPAGHYLKAPCTEPCGNSTC      1 - 70
LVCPQDTFLAWENHHNSECARCQACDEQASQVALENCSAVADTRCGCKPGWFVECQVSQCVSSSPFYCQP     71 - 140
CLDCGALHRHTRLLCSRRDTDCGTCLPGFYEHGDGCVSCPTSTLGSCPERCAAVCGWRQMFWVQVLLAGL    141 - 210
VVPLLLGATLTYTYRHCWPHKPLVTADEAGMEALTPPPATHLSPLDSAHTLLAPPDSSEKICTVQLVGNS    211 - 280
WTPGYPETQEALCPQVTWSWDQLPSRALGPAAAPTLSPESPAGSPAMMLQPGPQLYDVMDAVPARRWKEF    281 - 350
VRTLGLREAEIEAVEVEIGRFRDQQYEMLKRWRQQQPAGLGAVYAALERMGLDGCVEDLRSRLQRGP       351 - 417
//

Text Mined References (56)

PMID Year Title
26810853 2016 Biologics beyond TNF-? inhibitors and the effect of targeting the homologues TL1A-DR3 pathway in chronic inflammatory disorders.
26509650 2016 Soluble TL1A is sufficient for activation of death receptor 3.
26393680 2015 Expression and function of the TL1A/DR3 axis in chronic lymphocytic leukemia.
26072972 2015 TL1A as a Potential Local Inducer of IL17A Expression in Colon Mucosa of Inflammatory Bowel Disease Patients.
26065008 2015 Death Receptor 3 (TNFRSF25) Increases Mineral Apposition by Osteoblasts and Region Specific New Bone Formation in the Axial Skeleton of Male DBA/1 Mice.
26046454 2015 Human group3 innate lymphoid cells express DR3 and respond to TL1A with enhanced IL-22 production and IL-2-dependent proliferation.
25929035 2014 [Frequency of the occurrence of spliced variants of the messenger RNA DR3/LARD in herpesviral infection].
25509355 [DR3/LARD mRNA spliced variants' frequency at colorectal cancer].
25399326 2014 TL1-A can engage death receptor-3 and activate NF-kappa B in endothelial cells.
25370568 2015 The role of death receptor 3 in the biological behavior of hepatocellular carcinoma cells.
25269704 2015 A major population of mucosal memory CD4+ T cells, coexpressing IL-18R? and DR3, display innate lymphocyte functionality.
25083589 2014 Anti-cancer effect of tectochrysin in NSCLC cells through overexpression of death receptor and inactivation of STAT3.
25044706 2014 Regulation of early cartilage destruction in inflammatory arthritis by death receptor 3.
24832108 2014 TL1A increased the differentiation of peripheral Th17 in rheumatoid arthritis.
23658110 2013 Epigenetic modifications of Nrf2 by 3,3'-diindolylmethane in vitro in TRAMP C1 cell line and in vivo TRAMP prostate tumors.
23443464 2013 Expression of death receptor-3 in human breast cancer and its functional effects on breast cancer cells in vitro.
22956587 2012 T cell costimulation by TNFR superfamily (TNFRSF)4 and TNFRSF25 in the context of vaccination.
22641456 2012 Involvement of TL1A and DR3 in induction of ischaemia and inflammation in urinary bladder dysfunction in the elderly.
22043900 2012 Interleukin-32 enhances cytotoxic effect of natural killer cells to cancer cells via activation of death receptor 3.
21722370 2011 Survival advantages conferred to colon cancer cells by E-selectin-induced activation of the PI3K-NF?B survival axis downstream of Death receptor-3.
21672030 2011 Upregulation and nuclear localization of TNF-like cytokine 1A (TL1A) and its receptors DR3 and DcR3 in psoriatic skin lesions.
21153333 2011 The role of TNFRSF25:TNFSF15 in disease… and health?
20568250 2010 Common single nucleotide polymorphisms in immunoregulatory genes and multiple myeloma risk among women in Connecticut.
20125169 2010 Immunology: TL1A in the inflammatory network in autoimmune diseases.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19674013 HLA-B8, DR3: a new risk factor for graft failure after renal transplantation in patients with underlying immunoglobulin A nephropathy.
18411341 2008 Essential role of TNF receptor superfamily 25 (TNFRSF25) in the development of allergic lung inflammation.
17085968 2006 Altered gene expression of caspase-10, death receptor-3 and IGFBP-3 in preeclamptic placentas.
16986165 2006 Death receptor-3 mediates apoptosis in human osteoblasts under narrowly regulated conditions.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16517446 Vascular endothelial growth inhibitor (VEGI), an endogenous negative regulator of angiogenesis.
15760679 2005 Involvement of TL1A and DR3 in induction of pro-inflammatory cytokines and matrix metalloproteinase-9 in atherogenesis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15301860 2004 Identification of single nucleotide polymorphisms in the tumor necrosis factor (TNF) and TNF receptor superfamily in the Korean population.
15241467 2004 Death receptor 3 (DR3) gene duplication in a chromosome region 1p36.3: gene duplication is more prevalent in rheumatoid arthritis.
14759258 2004 An unappreciated role for RNA surveillance.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12882979 2003 TL1A-induced NF-kappaB activation and c-IAP2 production prevent DR3-mediated apoptosis in TF-1 cells.
12875962 2003 Expression of silencer of death domains and death-receptor-3 in normal human kidney and in rejecting renal transplants.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11911831 2002 TL1A is a TNF-like ligand for DR3 and TR6/DcR3 and functions as a T cell costimulator.
11819535 2000 The relationship of lmp2 and DR3 genes with susceptibility to type I diabetes mellitus in south China Han population.
11793848 2001 Relationship of large multifunctional proteasome 7 gene polymorphism with susceptibility to type 1 diabetes mellitus and DR3 gene.
11606045 2001 Heterogeneity in the phosphorylation of human death receptors by p42(mapk/erk2).
11181995 2001 The sequence of the human genome.
11094155 2000 Studies on the interaction between TWEAK and the death receptor WSL-1/TRAMP (DR3).
9915703 1999 Prevention of constitutive TNF receptor 1 signaling by silencer of death domains.
9615223 1998 Duplication of the DR3 gene on human chromosome 1p36 and its deletion in human neuroblastoma.
9446802 1998 A new death receptor 3 isoform: expression in human lymphoid cell lines and non-Hodgkin's lymphomas.
9114039 1997 LARD: a new lymphoid-specific death domain containing receptor regulated by alternative pre-mRNA splicing.
9052839 1997 TRAMP, a novel apoptosis-mediating receptor with sequence homology to tumor necrosis factor receptor 1 and Fas(Apo-1/CD95).
8994832 1996 Apo-3, a new member of the tumor necrosis factor receptor family, contains a death domain and activates apoptosis and NF-kappa B.
8934525 1996 A death-domain-containing receptor that mediates apoptosis.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8875942 1996 Signal transduction by DR3, a death domain-containing receptor related to TNFR-1 and CD95.