Property Summary

NCBI Gene PubMed Count 26
PubMed Score 35.44
PubTator Score 151.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
nasopharyngeal carcinoma -1.300 4.1e-02
astrocytoma 2.100 1.0e-13
posterior fossa group B ependymoma 3.700 1.4e-17
oligodendroglioma 1.900 2.0e-09
glioblastoma multiforme 2.800 2.4e-22
osteosarcoma 1.431 3.8e-02
cystic fibrosis 2.272 4.6e-06
periodontitis -1.100 5.5e-17
atypical teratoid/rhabdoid tumor 4.100 2.0e-10
medulloblastoma, large-cell 1.900 6.3e-03
primitive neuroectodermal tumor 2.400 1.1e-03
intraductal papillary-mucinous adenoma (... -1.500 3.9e-03
intraductal papillary-mucinous carcinoma... -1.600 5.2e-03
adult high grade glioma 2.600 3.5e-04
pilocytic astrocytoma 2.600 6.2e-09
sonic hedgehog group medulloblastoma 2.300 1.7e-04
psoriasis 1.100 1.3e-02
Breast cancer -2.000 4.9e-05
ovarian cancer 2.300 8.7e-04
pituitary cancer -2.300 6.9e-05

Gene RIF (13)

PMID Text
24623448 TNFRSF19 may contribute to the development of colorectal tumors with deregulated beta-catenin activity.
24129566 the association of RhoGDIalpha with TROY contributed to TROY-dependent RhoA activation and neurite outgrowth inhibition after Nogo-66 stimulation.
23699535 Results show aberrant expression and/or signaling by TROY as a contributor to the dispersion of glioblastoma cells and therapeutic resistance.
23142137 TROY is up-regulated in human colorectal cancer cell lines and in intestinal tumors in mice. It functions as a negative modulator of the Wnt pathway in LGR5-positive stem cells.
22057614 study demonstrated that TNFR2 and TROY mRNA levels are enhanced in cutaneous squamous cell carcinoma cells compared to healthy ones in a Tunisian population
21127458 The FAM134B and TNFRSF19 showed a dramatically strong synergistic epistasis in explaining the genetic dissection of the susceptibility to complex vascular dementia.
20881009 TNFRSF19 overexpression in glioma cells activates Rac1 signaling in a Pyk2-dependent manner to drive glioma cell invasion and migration
20512145 Findings provide new insights into the pathogenesis of NPC by highlighting the involvement of pathways related to TNFRSF19 and MDS1-EVI1 in addition to HLA molecules.
20512145 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
17239012 the ternary complex of NgR/TROY/LINGO-1 expressed on astrocytes, macrophages/microglia and neurones, by interacting with Nogo-A on oligodendrocytes, might modulate glial-neuronal interactions in demyelinating lesions of multiple sclerosis
17187358 TROY regulates melanoma growth.
15301860 Observational study of genotype prevalence. (HuGE Navigator)

AA Sequence

MALKVLLEQEKTFFTLLVLLGYLSCKVTCESGDCRQQEFRDRSGNCVPCNQCGPGMELSKECGFGYGEDA      1 - 70
QCVTCRLHRFKEDWGFQKCKPCLDCAVVNRFQKANCSATSDAICGDCLPGFYRKTKLVGFQDMECVPCGD     71 - 140
PPPPYEPHCASKVNLVKIASTASSPRDTALAAVICSALATVLLALLILCVIYCKRQFMEKKPSWSLRSQD    141 - 210
IQYNGSELSCFDRPQLHEYAHRACCQCRRDSVQTCGPVRLLPSMCCEEACSPNPATLGCGVHSAASLQAR    211 - 280
NAGPAGEMVPTFFGSLTQSICGEFSDAWPLMQNPMGGDNISFCDSYPELTGEDIHSLNPELESSTSLDSN    281 - 350
SSQDLVGGAVPVQSHSENFTAATDLSRYNNTLVESASTQDALTMRSQLDQESGAVIHPATQTSLQVRQRL    351 - 420
GSL                                                                       421 - 423
//

Text Mined References (29)

PMID Year Title
25189868 2015 Gene-smoking interactions identify several novel blood pressure loci in the Framingham Heart Study.
24623448 2014 ?-catenin regulates NF-?B activity via TNFRSF19 in colorectal cancer cells.
24129566 2013 TROY interacts with Rho guanine nucleotide dissociation inhibitor ? (RhoGDI?) to mediate Nogo-induced inhibition of neurite outgrowth.
23699535 2013 TROY (TNFRSF19) promotes glioblastoma survival signaling and therapeutic resistance.
23142137 2013 Troy, a tumor necrosis factor receptor family member, interacts with lgr5 to inhibit wnt signaling in intestinal stem cells.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
22493691 2012 Novel associations for hypothyroidism include known autoimmune risk loci.
22057614 2011 Tumor necrosis factor-receptor 2 and TROY gene expression patterns in cutaneous squamous cell carcinoma in a Tunisian population.
21127458 2011 A strong synergistic epistasis between FAM134B and TNFRSF19 on the susceptibility to vascular dementia.
20881009 2010 TROY (TNFRSF19) is overexpressed in advanced glial tumors and promotes glioblastoma cell invasion via Pyk2-Rac1 signaling.
20512145 2010 A genome-wide association study of nasopharyngeal carcinoma identifies three new susceptibility loci.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19641626 2009 Local network topology in human protein interaction data predicts functional association.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17239012 2007 TROY and LINGO-1 expression in astrocytes and macrophages/microglia in multiple sclerosis lesions.
17187358 2007 Tumor necrosis factor receptor superfamily member TROY is a novel melanoma biomarker and potential therapeutic target.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15694321 2005 A TNF receptor family member, TROY, is a coreceptor with Nogo receptor in mediating the inhibitory activity of myelin inhibitors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15301860 2004 Identification of single nucleotide polymorphisms in the tumor necrosis factor (TNF) and TNF receptor superfamily in the Korean population.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12060722 2002 TRAF6-deficient mice display hypohidrotic ectodermal dysplasia.
10809768 2000 TAJ, a novel member of the tumor necrosis factor receptor family, activates the c-Jun N-terminal kinase pathway and mediates caspase-independent cell death.
10764796 2000 TROY, a newly identified member of the tumor necrosis factor receptor superfamily, exhibits a homology with Edar and is expressed in embryonic skin and hair follicles.
7829101 1994 Isolation of novel and known genes from a human fetal cochlear cDNA library using subtractive hybridization and differential screening.